DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and ACOX2

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_003491.1 Gene:ACOX2 / 8309 HGNCID:120 Length:681 Species:Homo sapiens


Alignment Length:444 Identity:86/444 - (19%)
Similarity:150/444 - (33%) Gaps:161/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VDKELLAYPEVIPRDEMAQLENSLLPLKNYFVEPRETEETSPETLRQLGLYGLNVSTDYEGKGYG 142
            |:..:.:|||...:|             |||:...|..:.:......:.|....:....:|:..|
Human    53 VESIIHSYPEFSCKD-------------NYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELG 104

  Fly   143 WSASLMASEPDSTDINVTLGLQTHRVVVDLLKEVG-----------------------TPLQQQR 184
            ::...::.:         :.|..|||.|..|:.:|                       |.|....
Human   105 YAYRALSGD---------VALNIHRVFVRALRSLGSEEQIAKWDPLCKNIQIIATYAQTELGHGT 160

  Fly   185 YLQDLATGKLIGTEAIYEISPPEEDYFNTTAELFPEYGKWQLNGEKSFVICTPGERQLFLVLAQT 249
            |||.|.      |||.|:.:..|                        |||.:|       .|..|
Human   161 YLQGLE------TEATYDAATQE------------------------FVIHSP-------TLTAT 188

  Fly   250 QQPNVPGVLGRGTTIFLVDSQQ--EGVRLGEKHATFGCRKAEIRRVH----FEGVKLGE------ 302
            :.  .||.|||..|..||.:|.  .|.|.| .||..    ..||.:.    ..|:.:|:      
Human   189 KW--WPGDLGRSATHALVQAQLICSGARRG-MHAFI----VPIRSLQDHTPLPGIIIGDIGPKMD 246

  Fly   303 -DQV---------VGLPHDG--NRYSEQL--------------------VRSSRLRGSLVGLSLA 335
             ||.         |.:|.:.  :|:::.|                    ||...|.|.:  |.:.
Human   247 FDQTDNGFLQLNHVRVPRENMLSRFAQVLPDGTYVKLGTAQSNYLPMVVVRVELLSGEI--LPIL 309

  Fly   336 KKLLNELAQYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLY----LTAGLLDEFRAQDVT 396
            :|......:|:|...|..::..|.|...:........::...::.|    |...||:.|:.   :
Human   310 QKACVIAMRYSVIRRQSRLRPSDPEAKVLDYQTQQQKLFPQLAISYAFHFLAVSLLEFFQH---S 371

  Fly   397 LESAITKYFT-LRQVYAIASQNLGVVGPKSLLSGETTELGLRDAAQLCTQGESL 449
            ..:.:.:.|: |.:::|:::      |.|:::|            :.||||..:
Human   372 YTAILNQDFSFLPELHALST------GMKAMMS------------EFCTQGAEM 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 82/430 (19%)
CaiA 122..439 CDD:224871 73/388 (19%)
ACOX2NP_003491.1 ACAD 20..655 CDD:324545 86/444 (19%)
Microbody targeting signal. /evidence=ECO:0000255 679..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.