DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and Acads

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_071957.1 Gene:Acads / 64304 RGDID:620514 Length:414 Species:Rattus norvegicus


Alignment Length:404 Identity:95/404 - (23%)
Similarity:165/404 - (40%) Gaps:55/404 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RAESVEESPEQQRKLPTREPLAKNFFIGVVDKELLAYPEVIPRDEMAQLENS-LLPLKNYFVEPR 112
            |..:|.:|.|    ||....:.:.......:|||:..        .|||:.. |.|         
  Rat    26 RLHTVYQSVE----LPETHQMLRQTCRDFAEKELVPI--------AAQLDKEHLFP--------- 69

  Fly   113 ETEETSPETLRQLGLYGLNVSTDYEGKGYGWSASLMASEPDS---TDINVTLGLQTHRVVVDLLK 174
               .:..:.:.:|||..::|..:..|.|..:.|..:|.|..|   ....|.:.:.....:..:||
  Rat    70 ---TSQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRGCASTGVIMSVNNSLYLGPILK 131

  Fly   175 EVGTPLQQQRYLQDLATGKLIGTEAIYEISPP----EEDYFNTTAELFPEYGKWQLNGEKSFVIC 235
             .|:..|:|:::.....|..||   .:.:|.|    :....:|||.  .|...|.|||.|:: |.
  Rat   132 -FGSSQQKQQWITPFTNGDKIG---CFALSEPGNGSDAGAASTTAR--EEGDSWVLNGTKAW-IT 189

  Fly   236 TPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGVKL 300
            ...|....:|.|.|.:..    ..:|.:.|||.....|:.||:|....|.|.:....:.||..::
  Rat   190 NSWEASATVVFASTDRSR----QNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRI 250

  Fly   301 GEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELAQYTVNTTQCG---VQLQDLELT 362
            .::.::|.|..|.:.:.|.:...|:..:...|.:|:..|:...:|..|....|   .:||:::..
  Rat   251 PKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRHAFGAPLTKLQNIQFK 315

  Fly   363 RIHMSRAMCSVYAMESMLYLT--AGLLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGPKS 425
            ...|:      .|:||...||  |.:|.: ..:..|.|||:.|........||:.|.:.::|...
  Rat   316 LADMA------LALESARLLTWRAAMLKD-NKKPFTKESAMAKLAASEAATAISHQAIQILGGMG 373

  Fly   426 LLSGETTELGLRDA 439
            .::....|...|||
  Rat   374 YVTEMPAERYYRDA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 86/361 (24%)
CaiA 122..439 CDD:224871 79/328 (24%)
AcadsNP_071957.1 CaiA 35..414 CDD:224871 92/395 (23%)
SCAD_SBCAD 38..410 CDD:173847 89/388 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.