DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and ACOXL

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_011509706.1 Gene:ACOXL / 55289 HGNCID:25621 Length:610 Species:Homo sapiens


Alignment Length:367 Identity:71/367 - (19%)
Similarity:124/367 - (33%) Gaps:108/367 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PLQQQRYLQDLA--------TGKLIGTEAIYEISPPEEDYFNTTAELFPEYGKWQLNGEKSFVIC 235
            |||:|:|....|        ..:.|.|||.:::|..|                        |||.
Human    80 PLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQE------------------------FVID 120

  Fly   236 TPGERQLFLVLAQTQQPNVPGVL------GR--GTTIFLVDSQQE------GVRLGEKHATFGCR 286
            ||.|....:.:......|...|.      ||  |...|:|..:.|      ||...:.....|..
Human   121 TPCENAEKMYIGNAMYGNYAAVFAQLIIDGRSQGPHCFIVPVRDENGSLYPGVTAIDMMYKEGLH 185

  Fly   287 KAEIRRVHFEGVKLGEDQVV----GLPHDGNRYSEQLVRSSRLRGSL------------------ 329
            ..:...:.|:.|::..:.::    .:..||..:|....:|:|....|                  
Human   186 GVDNGILIFDKVRIPRENLLDKFGSVAPDGQYHSPIRNKSARFNAMLAALTPSRLAVAFQAMGAM 250

  Fly   330 -VGLSLAKKLLNELAQYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLTAGLLDE--FR 391
             :||::|.:..:...|:...|.: .|::.:.:...:.:...:.:..|:..:......||||  |:
Human   251 KLGLTIAIRYSHSRRQFGPKTKE-EVKIIEHQTQTLRLMPHLATALALTFVSRYAGALLDEDVFQ 314

  Fly   392 AQDVTLESAITKYFTLRQVYAIASQNLGVVGPKSLLSGETTELGLRDAAQLCT-----------Q 445
            .:::.         ..|.:.|:      |.|.|:..:.|.... |:|..: ||           .
Human   315 GKELV---------NSRSLQAL------VAGLKAYSTWENIRC-LQDCRE-CTGGMGYMMENRIS 362

  Fly   446 GESLDTLGMFIALTG-----LQHAGQAMNTGVRK--SRNPLF 480
            |...|| .:|....|     ||..|:.:.....|  ...|||
Human   363 GLKCDT-DVFATFEGDDVVMLQVVGRELLAQYTKQYEEKPLF 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 63/335 (19%)
CaiA 122..439 CDD:224871 56/306 (18%)
ACOXLXP_011509706.1 ACAD 2..575 CDD:299127 71/367 (19%)
PLN02636 34..575 CDD:215342 71/367 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.