DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and acads

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001003743.1 Gene:acads / 445288 ZFINID:ZDB-GENE-040808-64 Length:405 Species:Danio rerio


Alignment Length:355 Identity:79/355 - (22%)
Similarity:147/355 - (41%) Gaps:24/355 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EMAQLENSLLPLKNYFVEPRETEETSPETLRQLGLYGLNVSTDYEGKGYGWSASLMASEP----- 152
            :.||.|  |.|:.....:.........:.|..:|:..:.|.....|.|..:.|..:|.|.     
Zfish    40 DYAQKE--LAPIAGLLDKEHRFPAKQVQELGAMGVMAVEVPESLGGAGMDYLAYCLAVEELSRGC 102

  Fly   153 DSTDINVTLGLQTHRVVVDLLKEVGTPLQQQRYLQDLATGKLIGTEAIYEISPPEEDYFNTTAEL 217
            .||.:.|::   .:.:.:..:.:.|:..|:::::....||:.:|..|:.|  |.........:.|
Zfish   103 ASTGVIVSV---NNSLYIGPILKFGSEEQKKQWITPFTTGEKVGCFALSE--PGNGSDAGAASTL 162

  Fly   218 FPEYG-KWQLNGEKSFVICTPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHA 281
            ..:.| :|.|||.|:: |....:....:|.|.|.:    .:..:|.:.|||.....|:.||:|..
Zfish   163 AQQEGNEWVLNGTKAW-ITNSWDASATVVFATTDK----SLKHKGISAFLVPMPHPGLSLGKKED 222

  Fly   282 TFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELAQYT 346
            ..|.|.:....:..|..::....::|....|.:.:.|.:.|.||..:...|.:|:..|:..|.|.
Zfish   223 KLGIRASSTANIILEDCRIPLGNMLGERGMGFKIAMQTLDSGRLGIAAQALGIAQAALDCAADYA 287

  Fly   347 VNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLT--AGLLDEFRAQDVTLESAITKYFTLRQ 409
            ...|..|..:..|:..:..::.   ...|:||...||  |.||.:.: :..|.|:|:.|......
Zfish   288 HKRTAFGAPIGKLQAIQFKLAD---MAVAIESARLLTWKAALLRDAK-KPFTKEAAMAKLAASEA 348

  Fly   410 VYAIASQNLGVVGPKSLLSGETTELGLRDA 439
            ....:.|.:.|:|....::....|...|||
Zfish   349 ATFASHQAIQVLGGMGYVTDMPAERHYRDA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 79/355 (22%)
CaiA 122..439 CDD:224871 72/324 (22%)
acadsNP_001003743.1 CaiA 26..405 CDD:224871 79/355 (22%)
SCAD_SBCAD 29..401 CDD:173847 79/355 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.