DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and CG6638

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:404 Identity:94/404 - (23%)
Similarity:157/404 - (38%) Gaps:72/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EQQRKLPTREPLAKNFFIGVVDKELLAYPEVIPRDEMAQLENSLLPLKNYFVEPRETEETSP--E 120
            |.::||  || :|.|||                :.|:|.|...:..|.|:       ::..|  :
  Fly    41 EDRQKL--RE-VAFNFF----------------QKELAPLAKEIDKLDNF-------KDMRPFWK 79

  Fly   121 TLRQLGLYGLNVSTDYEGKGYGWSASLMASEPDSTDI-NVTLGLQTH-RVVVDLLKEVGTPLQQQ 183
            .|..||..|:....|:.|.|..:....:..|..|... .|.|....| .:.::.|.:.|||.|::
  Fly    80 KLGALGFLGITAEPDFGGTGGSYLDHCIIMEEFSRAAGGVALSYGAHSNLCINQLTKNGTPEQKE 144

  Fly   184 RYLQDLATGKLIGTEAIYEISPPEEDY-FNTTAELFPEYGKWQLNGEKSFVICTPGERQLFLVLA 247
            :||..|.:|:.:|..|:.|.....:.. ....||...:|  :.|||.| |.|....:....:|.|
  Fly   145 KYLPKLCSGEHVGGLAMSEPGAGSDVVSMKLRAERKGDY--YVLNGSK-FWITNGSDADTLIVYA 206

  Fly   248 QTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGVKLGEDQVVGLPHDG 312
            :|....||.  ..|.|.|:|::..||..:.:|....|.|.:....:.|:.:|:....::|..:.|
  Fly   207 KTGGSGVPD--KHGITAFIVETAWEGFSVAQKLDKLGMRGSSTCELVFQDLKVPAKNILGQENRG 269

  Fly   313 ------NRYSEQLVRSSRLRGSLVGLSLA-----------KKLLNELAQYTVNTTQCGVQLQDLE 360
                  ....|:||    |....|||..|           :|.:|:|             :.:.:
  Fly   270 VYVLMSGLDFERLV----LAAGPVGLMQAACDVAFDYAHQRKQMNKL-------------IGEFQ 317

  Fly   361 LTRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGPKS 425
            |.:..|:....::.|..|.||..|...|............|  .:|..:...:|...:.::|...
  Fly   318 LLQGKMADMYTTLSACRSYLYTVARSCDAGNRSPKDCAGVI--LYTAEKATKVALDAIQILGGNG 380

  Fly   426 LLSGETTELGLRDA 439
            .::...|...||||
  Fly   381 YINENPTGRILRDA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 85/370 (23%)
CaiA 122..439 CDD:224871 77/336 (23%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 94/404 (23%)
IVD 38..417 CDD:173845 94/404 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.