DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and Acad8

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_038938215.1 Gene:Acad8 / 367196 RGDID:1564209 Length:411 Species:Rattus norvegicus


Alignment Length:342 Identity:73/342 - (21%)
Similarity:135/342 - (39%) Gaps:13/342 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QLGLYGLNVSTDYEGKGYGWSASLMASEPDSTD-INVTLGLQTHRVVVDLLKEVGTPLQQQRYLQ 187
            |||..|:.|.||..|.|.....:.:..|..:|. .:.|..:..|.:...::...|...|:.::..
  Rat    79 QLGFGGIYVRTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCP 143

  Fly   188 DLATGKLIGTEAIYEI-SPPEEDYFNTTAELFPEYGKWQLNGEKSFVICTPGERQLFLVLAQTQQ 251
            .|.|.:...:..:.|. |..:.....|:|:...::  :.|||.|:| |...||..:::|:.:|  
  Rat   144 PLCTMEKFASYCLTEPGSGSDAASLLTSAKRQGDH--YILNGSKAF-ISGGGESDIYVVMCRT-- 203

  Fly   252 PNVPGVLG-RGTTIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRY 315
                |..| :|.:..:|:....|:..|:|....|......|.|.||...:.....:|....|...
  Rat   204 ----GGSGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGTEGQGFLI 264

  Fly   316 SEQLVRSSRLRGSLVGLSLAKKLLNELAQYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESML 380
            :.:.:...|:..:...|..|...:....::.....|.|..|...:..:..::.....:.|...|:
  Rat   265 AMKGLNGGRINVASCSLGAAHASVVLTQEHLKVRKQFGAPLARSQYLQFQLADMATKLVASRLMI 329

  Fly   381 YLTAGLLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGPKSLLSGETTELGLRDAAQLCTQ 445
            ...|..|.|.|...|.| .::.|.|...:.:.|.:|.|.:.|....|.....:..:||:......
  Rat   330 RTAAVALQEEREDAVAL-CSMAKLFVTEECFTICNQALQMHGGYGYLKDYAVQQYMRDSRVHQIL 393

  Fly   446 GESLDTLGMFIALTGLQ 462
            ..|.:.:.|.|:.:.||
  Rat   394 EGSNEVMRMLISRSLLQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 70/335 (21%)
CaiA 122..439 CDD:224871 67/317 (21%)
Acad8XP_038938215.1 IBD 37..410 CDD:173851 71/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D819314at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.