DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and ACADSB

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001600.1 Gene:ACADSB / 36 HGNCID:91 Length:432 Species:Homo sapiens


Alignment Length:358 Identity:89/358 - (24%)
Similarity:157/358 - (43%) Gaps:38/358 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DKELLAYPEVIPRDEMAQLENSLLPLKNYFVEPRETEETSPETLRQLGLYGLNVSTDYEGKGYGW 143
            |:|::....|   .:.||  ..:.||.:...|..:.|::..:.|.|.||.|:.|..:|.|.|..:
Human    59 DEEMMIKSSV---KKFAQ--EQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASF 118

  Fly   144 -SASLMASEPDSTDINVTLGLQTHRVVVD-LLKEVGTPLQQQRYLQDLATGKLIGTEAIYEISPP 206
             |..|:..|....|.:|.:..:....::: |:::.||..|:..||..|.|.| :|:..:.|....
Human   119 LSTVLVIEELAKVDASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEK-VGSFCLSEAGAG 182

  Fly   207 EEDY-FNTTAELFPEYGKWQLNGEKSFVICTPGERQLFLVLAQTQQPNVPGVLG-RGTTIFLVDS 269
            .:.: ..|.|:...:|  :.|||.|.: |.:.....||||:|     ||...:| :|.|.||||.
Human   183 SDSFALKTRADKEGDY--YVLNGSKMW-ISSAEHAGLFLVMA-----NVDPTIGYKGITSFLVDR 239

  Fly   270 QQEGVRLGEKHATFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSL 334
            ...|:.:|:.....|.|.:....:.||.||:.|..::|....|.:|:...:...|:..:...|.|
Human   240 DTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLGL 304

  Fly   335 AKKLLNELAQYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLES 399
            |:...:....|.....|.|.:|.|.:..:..::.....:.|...:.|..|.||:  ..:....|:
Human   305 AQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLE--AGKPFIKEA 367

  Fly   400 AITKYFTLRQVYAIASQNLGVVGPKSLLSGETT 432
            ::.||:.                  |.::|:||
Human   368 SMAKYYA------------------SEIAGQTT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 86/345 (25%)
CaiA 122..439 CDD:224871 80/315 (25%)
ACADSBNP_001600.1 CaiA 57..428 CDD:224871 89/358 (25%)
SCAD_SBCAD 59..430 CDD:173847 89/358 (25%)
Substrate binding. /evidence=ECO:0000269|Ref.15 291..294 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.