DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and CG9547

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_609040.1 Gene:CG9547 / 33911 FlyBaseID:FBgn0031824 Length:419 Species:Drosophila melanogaster


Alignment Length:481 Identity:107/481 - (22%)
Similarity:182/481 - (37%) Gaps:98/481 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLTYSRNGKLLTRGRSTKATSSSLDS---QHQDAATTEGGRAESVEESPEQQRKLPTREPLAKNF 73
            ::..|...||....|...:|||...:   ..||....|.              :|...|...::.
  Fly     1 MIAQSVISKLRPCARRLASTSSKAAAPKFNWQDPLNLES--------------QLTEEEVAIRDA 51

  Fly    74 FIGVVDKELLAYPEVIPRDEMAQLENSLLPLKNYFVEPRET-EETSPETLRQLGLYGLNVSTDYE 137
            |.|....||.      ||.:||   |.|           || ::...|.:..||:.|..:     
  Fly    52 FRGYCQAELQ------PRVKMA---NRL-----------ETFDKKIMEEIGSLGVLGCTI----- 91

  Fly   138 GKGYGWSA------SLMASEPDSTD--INVTLGLQTHRVVVDLLKEVGTPLQQQRYLQDLATGKL 194
             ||||.:.      .|:..|.:..|  ....:.:|: .:.:..:.:.|:..|:||||..:|.|||
  Fly    92 -KGYGCAGVSSVAYGLLTREVERVDSAYRSAVSVQS-SLAMGAIYDFGSEEQKQRYLPSMAEGKL 154

  Fly   195 IG----TEAIYEISPPEEDYFNTTAELFPEYGKWQLNGEKSFVICTPGERQLFLVLAQTQQPNVP 255
            ||    ||..:...|..   ..|.|:...:...:.|||.|:::...| ...:.:|.|:.:...|.
  Fly   155 IGAFGLTEPNHGSDPAG---METRAKYDSKSKTYILNGSKTWITSAP-IADVIVVWAKCEDGKVR 215

  Fly   256 GVLGRGTTIFLVDSQ--QEGVRLGEKHATFGCRKAEIRRVHFEGVKLGEDQVVGLPH-DGNRYSE 317
            |        ||||.:  .:|:...:....|..|.:....:..:.|::.|:|:  ||: .|.....
  Fly   216 G--------FLVDRKISGKGLETPKIEGKFSLRASPTGMILMDEVRVPEEQL--LPNVAGFSGPF 270

  Fly   318 QLVRSSRLRGSLVGLSLAKKLLNELAQYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYL 382
            ..:.::|...:...|..|:..:....|||::..|.|..|...:|.:..::.|:..: |:.....|
  Fly   271 SCLNNARYGIAWGALGAAETCVEIARQYTLDRKQFGRPLAANQLIQKKLADAITEI-ALGLQACL 334

  Fly   383 TAGLLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGPKSL------------LSGETTELG 435
            ..|.|.:.:.....:.|.:.:..|.:.: .||.|...::|...:            |....|..|
  Fly   335 HVGRLKDQKLHTPDMISLLKRNNTGKSL-DIARQMRDMLGANGISDEYHVIRHVINLESVNTYEG 398

  Fly   436 LRDAAQLCTQGESLDTLGMFIALTGL 461
            ..|...|        .||.  |:|||
  Fly   399 THDIHAL--------ILGR--AITGL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 85/392 (22%)
CaiA 122..439 CDD:224871 74/343 (22%)
CG9547NP_609040.1 GCD 29..417 CDD:173840 100/453 (22%)
CaiA 41..417 CDD:224871 97/427 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.