DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and Acoxl

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_017447070.1 Gene:Acoxl / 296138 RGDID:1306814 Length:656 Species:Rattus norvegicus


Alignment Length:348 Identity:68/348 - (19%)
Similarity:112/348 - (32%) Gaps:126/348 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PLQQQRYLQDLATGKL-------------IGTEAIYEISPPEEDYFNTTAELFPEYGKWQLNGEK 230
            ||::|:|     ||..             |.|||.::....|                       
  Rat   130 PLKEQKY-----TGMFAMTEKGHGSNIRGIQTEATFDCDSQE----------------------- 166

  Fly   231 SFVICTPGERQLFLVLAQTQQPNVPGVL--------GRGTTIFLVDSQQE------GVRLGEKHA 281
             |||..|.|....:.:......|...|.        .:|...|:|..:.|      ||...:...
  Rat   167 -FVIDMPCENAQKMYIGNAMHGNYAAVFAQLIIEGKSQGPHCFIVPIRDENGNLYPGVTAIDMMY 230

  Fly   282 TFGCRKAEIRRVHFEGVKLGE----DQVVGLPHDGNRYSEQLVRSSRLRGSL------------- 329
            ..|....:...:.|:.|::..    |::..:..||..:|....:|:|....|             
  Rat   231 KEGLNGVDNGILIFDKVRIPRENMLDKLGSVTPDGQYHSPIQSKSARFNAMLAILTPSRLAVTFQ 295

  Fly   330 ------VGLSLAKKLLNELAQYTVNTTQCGV-----------QLQDLELTRIHMSRAMCSVYAME 377
                  :||.:|       .:|:.:..|.|.           |:|.|.|.. |::.|:...:...
  Rat   296 AMGAMKLGLMIA-------IRYSHSRRQFGPKGKEEVKIIEHQMQALRLMS-HLATALALTFTSR 352

  Fly   378 SMLYLTAG-LLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGPKSLLSGETTELGLRDAAQ 441
            .     || :|||...|...|       ...|.:.|:      :.|.|:..:.||... |:|..:
  Rat   353 H-----AGHILDEDILQGREL-------INRRSLQAL------MAGLKAYSTWETVRC-LQDCRE 398

  Fly   442 LCTQGESLDTLGMFI--ALTGLQ 462
             ||.|     :|..:  .|:||:
  Rat   399 -CTGG-----MGYMMENRLSGLK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 65/341 (19%)
CaiA 122..439 CDD:224871 60/321 (19%)
AcoxlXP_017447070.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.