DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and acdh-4

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001300435.1 Gene:acdh-4 / 172367 WormBaseID:WBGene00020419 Length:385 Species:Caenorhabditis elegans


Alignment Length:340 Identity:76/340 - (22%)
Similarity:147/340 - (43%) Gaps:34/340 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PRDE---------MAQLENSLLPLKNYF----VEP--RETEETSPETLRQL------GLYGLNVS 133
            ||:|         :::.|...:.....|    ::|  ||.:.||..|...:      ||.|:.|.
 Worm    28 PRNEDDIPHPLQVLSEQETGFVKTVRQFADTVIKPLVREMDRTSEMTPAVINGCFENGLMGIEVP 92

  Fly   134 TDYEGKGYG-WSASLMASEPDSTDINVTLGLQTHRVV-VDLLKEVGTPLQQQRYLQDLATGKLIG 196
            ..|.|.|.. :.|:|:..|....|.:|...:..|..: :.|:.|:||..|:::||....|.. :|
 Worm    93 EKYGGPGATFFDAALVIEEISKVDASVGAMVDVHNTLFIPLIIELGTEKQKEKYLPKCYTSS-VG 156

  Fly   197 TEAIYEISPPEEDY-FNTTAELFPEYGKWQLNGEKSFVICTPGERQLFLVLAQTQQPNVPGVLGR 260
            :.|:.|.....:.: ..|||:  .:...:.:||.|.: |....:.:.|||.|...    |....:
 Worm   157 SFALSETGSGSDAFALKTTAK--KDGDDYVINGSKMW-ISNSEQSETFLVFANAD----PSKGYK 214

  Fly   261 GTTIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRL 325
            |.|.|:|:...:|..:|:.....|.|.:....:||:.|::.:..::|....|.:|:.:.:.:.|:
 Worm   215 GITCFIVEKGTKGFTIGKHEDKLGVRSSSTCPLHFDNVRVHKSAILGEFGKGYKYAIEYLNAGRI 279

  Fly   326 RGSLVGLSLAKKLLNELAQYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLTAGLLDEF 390
            ......|.||:...::...|.....|.|.::.|.:..:..:::....:.|...::|..|.:  :.
 Worm   280 GIGAQMLGLAQGCFDQTIPYLQQREQFGQRIIDFQGMQHQIAQVRTEIEAARLLVYNAARM--KQ 342

  Fly   391 RAQDVTLESAITKYF 405
            .......|:|:.|.|
 Worm   343 HGLPFVREAAMAKLF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 74/338 (22%)
CaiA 122..439 CDD:224871 65/293 (22%)
acdh-4NP_001300435.1 CaiA 41..359 CDD:224871 73/327 (22%)
ACAD 43..359 CDD:299127 73/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.