DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and Acox1

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001258827.1 Gene:Acox1 / 11430 MGIID:1330812 Length:661 Species:Mus musculus


Alignment Length:451 Identity:92/451 - (20%)
Similarity:145/451 - (32%) Gaps:152/451 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLLTYSRNGKLLTRGRSTKATSSSLDSQHQDAATTEGGRAESVEESPEQQRKLPTREPLAKNF- 73
            |..|||..  .:..|.....:.:.||..     |.|...|..:|....|.:|..|  ||...:| 
Mouse   270 SNKLTYGT--MVFVRSFLVGSAAQSLSK-----ACTIAIRYSAVRRQSEIKRSEP--EPQILDFQ 325

  Fly    74 -----------------FIGVVDKE-LLAYPEVIPRDEMAQLENSLLPLKNYFVEPRETEETSPE 120
                             |:|...|| .:...|.|.:.::::|                     ||
Mouse   326 TQQYKLFPLLATAYAFHFLGRYIKETYMRINESIGQGDLSEL---------------------PE 369

  Fly   121 TLRQLGLYGLNVSTDYE-------------GKGYGWSASL----MASEPDST--DINVTLGLQTH 166
             |..| ..||...|.:.             |.||..|:.:    :...|..|  ..|..:.|||.
Mouse   370 -LHAL-TAGLKAFTTWTANAGIEECRMACGGHGYSHSSGIPNIYVTFTPACTFEGENTVMMLQTA 432

  Fly   167 RVVVDLLKEVGTPLQQQRYLQDLATGKLIGTEAIY-------EISPPEEDYFNTTAEL-----FP 219
            |.::.:..:|             .:|||:|....|       .|.|.:...:.|..::     ..
Mouse   433 RFLMKIYDQV-------------QSGKLVGGMVSYLNDLPSQRIQPQQVAVWPTLVDINSLDSLT 484

  Fly   220 EYGKWQLNGEKSFVICTPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFG 284
            |  .::|...:...|....      :.||........|....|::.|       ||..|.|.   
Mouse   485 E--AYKLRAARLVEIAAKN------LQAQVSHRKSKEVAWNLTSVDL-------VRASEAHC--- 531

  Fly   285 CRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLS------LAKKLLNELA 343
                     |:..||:..|:   ||...:|..:.::|:..|..||.|:|      |...::....
Mouse   532 ---------HYVTVKVFADK---LPKIQDRAVQAVLRNLCLLYSLYGISQKGGDFLEGNIITGAQ 584

  Fly   344 QYTVNTTQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLESAITKY 404
            ...||:       :.|||..:....|:              .|:|.|..:||||.|.:.:|
Mouse   585 MSQVNS-------RILELLTVTRPNAV--------------ALVDAFDFKDVTLGSVLGRY 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 69/350 (20%)
CaiA 122..439 CDD:224871 66/320 (21%)
Acox1NP_001258827.1 AXO 3..638 CDD:173839 92/451 (20%)
Microbody targeting signal 659..661
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.