DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and Acads

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_031409.2 Gene:Acads / 11409 MGIID:87868 Length:412 Species:Mus musculus


Alignment Length:406 Identity:93/406 - (22%)
Similarity:165/406 - (40%) Gaps:59/406 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RAESVEESPEQQRKLPTREPLAKNFFIGVVDKELLAYPEVIPRDEM---AQLENSLLPLKNYFVE 110
            |..:|.:|.|    ||....:.:.......:|||:.....:.|:.:   ||::.           
Mouse    24 RLHTVYQSVE----LPETHQMLRQTCRDFAEKELVPIAAQLDREHLFPTAQVKK----------- 73

  Fly   111 PRETEETSPETLRQLGLYGLNVSTDYEGKGYGWSASLMASEPDS---TDINVTLGLQTHRVVVDL 172
                       :.:|||..::|..:..|.|..:.|..:|.|..|   ....|.:.:.....:..:
Mouse    74 -----------MGELGLLAMDVPEELSGAGLDYLAYSIALEEISRACASTGVIMSVNNSLYLGPI 127

  Fly   173 LKEVGTPLQQQRYLQDLATGKLIGTEAIYEISPP----EEDYFNTTAELFPEYGKWQLNGEKSFV 233
            || .|:..|:|:::.....|..||   .:.:|.|    :....:|||.  .|...|.|||.|:: 
Mouse   128 LK-FGSAQQKQQWITPFTNGDKIG---CFALSEPGNGSDAGAASTTAR--EEGDSWVLNGTKAW- 185

  Fly   234 ICTPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGV 298
            |....|....:|.|.|.:..    ..:|.:.|||.....|:.||:|....|.|.:....:.||..
Mouse   186 ITNSWEASATVVFASTDRSR----QNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDC 246

  Fly   299 KLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELAQYTVNTTQCG---VQLQDLE 360
            ::.::.::|.|..|.:.:.|.:...|:..:...|.:|:..|:...:|..|....|   .:||:::
Mouse   247 RIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRNAFGAPLTKLQNIQ 311

  Fly   361 LTRIHMSRAMCSVYAMESMLYLT--AGLLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGP 423
            .....|:      .|:||...||  |.:|.: ..:..|.|||:.|........||:.|.:.::|.
Mouse   312 FKLADMA------LALESARLLTWRAAMLKD-NKKPFTKESAMAKLAASEAATAISHQAIQILGG 369

  Fly   424 KSLLSGETTELGLRDA 439
            ...::....|...|||
Mouse   370 MGYVTEMPAERYYRDA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 83/363 (23%)
CaiA 122..439 CDD:224871 79/328 (24%)
AcadsNP_031409.2 SCAD_SBCAD 36..408 CDD:173847 87/390 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P15651 269..272 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.