DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and Acadm

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_031408.1 Gene:Acadm / 11364 MGIID:87867 Length:421 Species:Mus musculus


Alignment Length:428 Identity:93/428 - (21%)
Similarity:167/428 - (39%) Gaps:80/428 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SQHQDAA-TTEGGRAESVEESPEQQRKLPTREPLAKNFFIGVVDKELLAYPEVIPRDEMAQLENS 100
            :||..|| ..|.|...|.|.: |||::.   :..|:.|          |..|:||          
Mouse    22 TQHSKAAHKQEPGLGFSFELT-EQQKEF---QATARKF----------AREEIIP---------- 62

  Fly   101 LLPLKNYFVEP---RETEETSPETLR--QLGLYGLNVSTDYEGKGYG-WSASLMASEPDSTDINV 159
                    |.|   :..|...|...|  :|||...::.....|.|.| :.|.|:..|.......|
Mouse    63 --------VAPEYDKSGEYPFPLIKRAWELGLINAHIPESCGGLGLGTFDACLITEELAYGCTGV 119

  Fly   160 TLGLQTHRVVVDLLKEVGTPLQQQRYLQDLATGKLIGTEAIYEISPPEE-DYFNTTAELFPEYGK 223
            ...::.:.:....:...|...|:::||..:....::....:.|.|...: ....|.||  .:..:
Mouse   120 QTAIEANSLGQMPVILAGNDQQKKKYLGRMTEQPMMCAYCVTEPSAGSDVAAIKTKAE--KKGDE 182

  Fly   224 WQLNGEKSFVICTPGERQLFLVLAQTQ-QPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFGCRK 287
            :.:||:|.: |...|:...:.:||::. .|.||.  .:..|.|:|::...|:.:|:|....|.|.
Mouse   183 YVINGQKMW-ITNGGKANWYFLLARSNPDPKVPA--SKAFTGFIVEADTPGIHIGKKELNMGQRC 244

  Fly   288 AEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQLVRSSRLRGSLV--GLSLAKKLLNELAQYTVNTT 350
            ::.|.:.||.|::.::.|  |..:|..:...:....|.|.::.  .:.||::.|:|..:|.::..
Mouse   245 SDTRGIAFEDVRVPKENV--LIGEGAGFKIAMGAFDRTRPTVAAGAVGLAQRALDEATKYALDRK 307

  Fly   351 QCGVQLQD--------------LELTRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLESAI 401
            ..|..|.:              :||.|:...||...|              |..|..  |..::|
Mouse   308 TFGKLLVEHQGVSFLLAEMAMKVELARLSYQRAAWEV--------------DSGRRN--TYYASI 356

  Fly   402 TKYFTLRQVYAIASQNLGVVGPKSLLSGETTELGLRDA 439
            .|.|.......:|:..:.:.|.....:....|..:|||
Mouse   357 AKAFAGDIANQLATDAVQIFGGYGFNTEYPVEKLMRDA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 76/372 (20%)
CaiA 122..439 CDD:224871 70/337 (21%)
AcadmNP_031408.1 CaiA 39..420 CDD:224871 86/411 (21%)
MCAD 41..418 CDD:173846 85/409 (21%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P41367 278..281 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.