DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and acad8

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_002938027.1 Gene:acad8 / 100495757 XenbaseID:XB-GENE-955812 Length:414 Species:Xenopus tropicalis


Alignment Length:431 Identity:99/431 - (22%)
Similarity:153/431 - (35%) Gaps:107/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ETEETSPETLRQ---LGLYGLNVSTDYEGKGYGWSASLMASEPDSTD-INVTLGLQTHRVVVDLL 173
            |.|....||:|:   ||..|:...||..|.|.....:.:..|..||. ::.|..:..|.:.|.::
 Frog    68 EKEVFPVETMRKAAHLGFGGIYAQTDVGGSGLSRLDTSIIFEALSTGCVSTTAYMSIHNMCVWMI 132

  Fly   174 KEVGTPLQQQRYLQDLATGKLIGTEAIYEISPP----EEDYFNTTAELFPEYGKWQLNGEKSFVI 234
            ...|...|:.::...|.:   :...|.|.::.|    :.....|:|:...:|  :.|||.|:| |
 Frog   133 DTYGNEEQRHQFCPSLCS---MDKFASYCLTEPGSGSDAASLLTSAKRDGDY--YILNGSKAF-I 191

  Fly   235 CTPGERQLFLVLAQTQQPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGVK 299
            ...|:..:::|:.:|     .|...||.:..:|:....|:..|:|....|......|.|.|    
 Frog   192 SGGGDTDVYVVMCRT-----GGSGARGISCLVVEKGIPGLSFGKKEKKVGWNSQPTRAVIF---- 247

  Fly   300 LGEDQVVGLPHDGNRYSEQLVRSSRLRGSLVGLSLAKKLLNELAQYTVNTTQC--GVQLQDLELT 362
              ||.||.:             .:||.....|.|:|.|.||   ...:|...|  |.....:.|.
 Frog   248 --EDCVVPV-------------KNRLGKEGQGFSIAMKGLN---GGRINIASCSLGAAHASVLLA 294

  Fly   363 RIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLESAITKYFTLRQVYAIASQNLGVVGPKSLL 427
            |.|:.........:....||      :|:..|:.     |:..|.|.:...|:|         .|
 Frog   295 RDHLGVRKQFGEPLSHNQYL------QFKLADMA-----TRLVTARLIVRHAAQ---------AL 339

  Fly   428 SGETTELGLRDAAQLCTQGESLDTLGMF-IALTGLQ-HAG------QAMNTGVRKSRNPLFNPGH 484
            ..:|     .|||.||...:...|...| |....|| |.|      .|:...||..|        
 Frog   340 QNDT-----GDAATLCAMAKLFATDECFKICNQALQMHGGYGYLKDYAVQQFVRDIR-------- 391

  Fly   485 IFGKFLDNNSIDNPKTKMQLSEHVHPSLEAAAQCIELSVAR 525
                                   ||..||...:.:.:.|||
 Frog   392 -----------------------VHQILEGTNEVMRMIVAR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 83/354 (23%)
CaiA 122..439 CDD:224871 72/326 (22%)
acad8XP_002938027.1 IBD 40..414 CDD:173851 99/431 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D819314at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.