DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Egm and acadm

DIOPT Version :9

Sequence 1:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_002936129.3 Gene:acadm / 100494748 XenbaseID:XB-GENE-972935 Length:423 Species:Xenopus tropicalis


Alignment Length:421 Identity:94/421 - (22%)
Similarity:174/421 - (41%) Gaps:54/421 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QHQDAATTEGGRAESVEESPEQQRKLPTREPLAKNFFIGVVDKELLAYPEVIPRDEMAQLENSLL 102
            ||   .|..|.|..|.  :|.......::..|..||.:....||..|......|:|       ::
 Frog    11 QH---ITRCGWRTHST--APNAAAAASSQGSLGFNFELSEQQKEFKATARKFAREE-------IM 63

  Fly   103 PLKNYFVEPRETEETSPETLRQLGLYGLNVSTDYEGKGYGWSASLMASEPDSTDINVTLGLQTHR 167
            ||..::.:..|......:...:|||...::..:..|...|...:.:.:|..:....   |:|| .
 Frog    64 PLAAHYDKTGEYPVPLIKRAWELGLMNGHIPENCGGLALGIFDTCLITEEIAYGCT---GVQT-A 124

  Fly   168 VVVDLLKEV-----GTPLQQQRYLQDLATGKLIGTEAIYEISPP----EEDYFNTTAELFPEYGK 223
            :..:.|.::     |...|:::||..:....|:   ..|.::.|    :.....|.||  .:..:
 Frog   125 IEANSLGQMPVIIAGNEAQKKKYLGRMMEEPLM---CAYCVTEPGAGSDVAGLKTRAE--KKGNE 184

  Fly   224 WQLNGEKSFVICTPGERQLFLVLAQTQ-QPNVPGVLGRGTTIFLVDSQQEGVRLGEKHATFGCRK 287
            :.:||:|.: |...|:...:.:||:|. .|.||.  .:..|.|:|::...|:::|.|....|.|.
 Frog   185 YIINGQKMW-ITNGGKANWYFLLARTNPDPKVPA--SKAFTGFIVEADSPGIQIGRKEMNMGQRC 246

  Fly   288 AEIRRVHFEGVKL-GEDQVVGLPHDGNRYSEQLVRSSRLRGSLV--GLSLAKKLLNELAQYTVNT 349
            ::.|.:.||.|:: .|:.::|   :|..:...:....:.|..:.  .:.||::.|:|..:|.|..
 Frog   247 SDTRGIVFEDVRVPAENVLIG---EGAGFKIAMGAFDKTRPPVAAGAVGLAQRALDEATKYAVER 308

  Fly   350 TQCGVQLQDLELTRIHMSRAMCSVYAMESMLYLTAGLLDEFRAQDVTLESAITKYFTLRQVYA-- 412
            ...|      :|...|  :|:..:.|..:|....|.|..:..|.:|......|.|.::.:.||  
 Frog   309 KTFG------KLIAEH--QAVSFMLAEMAMKVELARLAYQRAAWEVDAGRRNTYYASIAKAYAGD 365

  Fly   413 ----IASQNLGVVGPKSLLSGETTELGLRDA 439
                :||..:.|.|.....|....|..:|||
 Frog   366 IANQVASDAVQVFGGNGFNSDYPVEKLMRDA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EgmNP_610687.1 ACAD 92..457 CDD:173838 80/367 (22%)
CaiA 122..439 CDD:224871 74/335 (22%)
acadmXP_002936129.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.