DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tou and chd4b

DIOPT Version :9

Sequence 1:NP_001097270.1 Gene:tou / 36241 FlyBaseID:FBgn0033636 Length:3131 Species:Drosophila melanogaster
Sequence 2:XP_021322613.1 Gene:chd4b / 560622 ZFINID:ZDB-GENE-030131-4532 Length:1953 Species:Danio rerio


Alignment Length:430 Identity:103/430 - (23%)
Similarity:155/430 - (36%) Gaps:149/430 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  2397 NSL-NPSSFNERTMALAAAAAASGPGNATGVANSAVVAGATPCESGSGEPNSGNAS-----PASN 2455
            ||| |..:|::....|   .||..|..|  |:...:|.||...|..:..|..|:||     .|:|
Zfish   166 NSLTNYKAFSQFVRPL---IAAKNPKIA--VSKMMMVLGAKWREFSTNNPMRGSASANAALAAAN 225

  Fly  2456 CDSDRDEKVEQIPKG------LVQWRDAVSRSHTTAQLAMALYVLESCVAWDKSIMKAYATKNKS 2514
            ..:..:..|.::..|      |     |.:...|||          :.||......:..|...:.
Zfish   226 VAAAVESMVTKVDAGGGGGPAL-----ATAPPTTTA----------APVAAPPPPQQPPAVPLRK 275

  Fly  2515 SKKKS----SAKKQATPSKKQQQKKNKKEQQLTPNGKESKSKSAINKPENQAPLSIKI-NLKALA 2574
            :|.|.    :|:::..|:.|.|.||             ||:|..       |||.||: |.|   
Zfish   276 AKTKEGKGPNARRKTKPTPKPQDKK-------------SKAKKV-------APLKIKLGNFK--- 317

  Fly  2575 QNGQCLLKTKTPPILTKSPTASPSSHPNTSDSDSDF------------GKRTK-KKSGGKRRRSA 2626
                                ...||.....|.:|||            ..|:| ||:...:::..
Zfish   318 --------------------RKRSSSGEEDDGESDFDSFSVSDGSNSRSSRSKNKKAKSSKKKKK 362

  Fly  2627 NNTNSSKYSNSLQN-CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYEC----- 2685
            .:.::..|....|: |:.|..|   .:::|||.|.:.||..|..|.|:..|:|.|.|..|     
Zfish   363 MDEDADGYETDHQDYCEVCQQG---GEIILCDTCPRAYHMVCLDPDMERAPEGTWSCPHCEKEGI 424

  Fly  2686 ---VNKATNERK-----------------------CIVCGGHRPSPVGKMIYCDLCPRAYHADCY 2724
               ..:.::|.:                       |.||     ...|:::.||.||.:||..|.
Zfish   425 QWEAREESSEGEEENDDGRRDDGDVEEEDDHHMEFCRVC-----KDGGELLCCDTCPSSYHLHCL 484

  Fly  2725 IPPLLKVPRGKWYCHGCIS----------------RAPPP 2748
            .|||..:|.|:|.|..|:|                .||||
Zfish   485 NPPLPDIPNGEWICPRCLSPPLKGKVQKVLTWRWGEAPPP 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
touNP_001097270.1 HAT_MBD 953..1027 CDD:238691
ZapA 1021..1127 CDD:294720
MAP7 1043..1198 CDD:283355
RILP-like 1085..>1179 CDD:304877
DDT 1255..1317 CDD:280886
WHIM1 1406..1455 CDD:292246
WHIM3 2190..2224 CDD:292248
PHD_BAZ2A_like 2640..2685 CDD:277020 16/45 (36%)
RanBP2-type Zn finger 2640..2659 CDD:275375 6/19 (32%)
RanBP2-type Zn finger 2680..2698 CDD:275376 5/48 (10%)
PHD 2695..2744 CDD:279022 20/64 (31%)
Bromo_BAZ2A_B_like 3027..3123 CDD:99935
chd4bXP_021322613.1 CHDNT 155..210 CDD:311840 15/48 (31%)
PHD1_CHD_II 377..419 CDD:277006 16/44 (36%)
PHD2_CHD_II 459..501 CDD:277007 18/46 (39%)
CHROMO <546..585 CDD:237991
CHROMO 634..686 CDD:214605
SNF2_N 734..>1274 CDD:331286
DUF1087 1308..1358 CDD:310812
DUF1086 1397..1531 CDD:310809
Neuromodulin_N <1534..>1738 CDD:331332
CHDCT2 1769..1939 CDD:311841
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.