DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tou and Lpt

DIOPT Version :9

Sequence 1:NP_001097270.1 Gene:tou / 36241 FlyBaseID:FBgn0033636 Length:3131 Species:Drosophila melanogaster
Sequence 2:NP_611847.2 Gene:Lpt / 37795 FlyBaseID:FBgn0263667 Length:1482 Species:Drosophila melanogaster


Alignment Length:391 Identity:88/391 - (22%)
Similarity:121/391 - (30%) Gaps:152/391 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  2436 TPCESGSGEPNSGNASPASNCDSDRDEKVEQIPKGLVQWRDAVSRSHTTAQLAMALYVLESCVAW 2500
            |.|  ||..|..|::|                     :|     .||.|        :.:||   
  Fly   302 TDC--GSRTPGGGSSS---------------------RW-----HSHYT--------ICDSC--- 327

  Fly  2501 DKSIMKAYATKNKSSKKKSSAKKQATPSKKQQQK---------------------KNKKEQQ--- 2541
                   |..:||........|.....|.|:..|                     ..||||.   
  Fly   328 -------YQQRNKGFSCPICQKAYRAASHKEMVKCSWCNKFVHSTCDEEADLTAYHKKKEQNPDY 385

  Fly  2542 --LTPNGKESKSKSAINKPENQAPLSIKINLKAL-AQNGQCLLKTKTPPILTKSPTASPSS---H 2600
              :.||.|.:.|     .|.:.......|.|.|: :.:.|..||......|...||..|||   |
  Fly   386 DYVCPNCKSNSS-----GPGSSQQTIDSIVLSAMDSSSEQLSLKEIELDPLEGKPTMDPSSDELH 445

  Fly  2601 PNTSDSDSDFGKR--------------------------TKKKSGGKRRRSANNTNSS------- 2632
            ...:      ||:                          .|:.:.||.|:.|..|.||       
  Fly   446 KLPT------GKKKVCLTSVRGRSGKFVLHRMGVMSQINKKRSTRGKGRQLALPTISSDRCLSRS 504

  Fly  2633 ------------------KYSNSLQNCQFCTS-G-ENEDKLLLCDGCDKGYHTYC--FKPKMDNI 2675
                              |:..:...|..|.| | |::..::.|..|.:.||.||  .||....:
  Fly   505 METDLTSDKKLLLCSARDKFIQAQDICVMCGSLGIESDSVMITCAQCGQCYHPYCAGVKPSRGIL 569

  Fly  2676 PDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHG 2740
            ..| |.|.:|.       .|..||  :.:...:::.||.|..:||..|..|||..||.|.|.|..
  Fly   570 QKG-WRCLDCT-------VCEGCG--KKNDEARLLLCDECDISYHIYCVNPPLETVPTGNWKCSF 624

  Fly  2741 C 2741
            |
  Fly   625 C 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
touNP_001097270.1 HAT_MBD 953..1027 CDD:238691
ZapA 1021..1127 CDD:294720
MAP7 1043..1198 CDD:283355
RILP-like 1085..>1179 CDD:304877
DDT 1255..1317 CDD:280886
WHIM1 1406..1455 CDD:292246
WHIM3 2190..2224 CDD:292248
PHD_BAZ2A_like 2640..2685 CDD:277020 16/48 (33%)
RanBP2-type Zn finger 2640..2659 CDD:275375 6/20 (30%)
RanBP2-type Zn finger 2680..2698 CDD:275376 4/17 (24%)
PHD 2695..2744 CDD:279022 18/47 (38%)
Bromo_BAZ2A_B_like 3027..3123 CDD:99935
LptNP_611847.2 ePHD1_KMT2C_like 109..191 CDD:277135
PHD1_KMT2C_like 205..250 CDD:276984
PHD2_KMT2C_like 252..298 CDD:276985
PHD_SF 337..392 CDD:304600 9/54 (17%)
PHD4_KMT2C_like 530..578 CDD:276987 16/48 (33%)
PHD5_KMT2C_like 580..625 CDD:276988 17/46 (37%)
PHD6_KMT2C_like 657..707 CDD:276989
NHP6B 1101..>1237 CDD:227935
HMG 1173..1231 CDD:197700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.