DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tou and Aire

DIOPT Version :9

Sequence 1:NP_001097270.1 Gene:tou / 36241 FlyBaseID:FBgn0033636 Length:3131 Species:Drosophila melanogaster
Sequence 2:XP_006256309.1 Gene:Aire / 294328 RGDID:1311139 Length:551 Species:Rattus norvegicus


Alignment Length:498 Identity:106/498 - (21%)
Similarity:167/498 - (33%) Gaps:145/498 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  2513 KSSKKKSSAKKQATPSKKQQQKKNKKEQQLTP-----------NGKESKSKSAINKPE-----NQ 2561
            |..|..:..|....|.:...:::..:|.:.||           .|..||:|.. .|||     .:
  Rat   112 KGRKPLAGPKASVVPPRPPTKRRALEEPRATPPATLASKSISSPGSHSKAKPP-KKPEGNLESQR 175

  Fly  2562 APLSIKINLKALAQNGQCLLKTKTPPILTKSPTASPSSHPNTSDSDSDFGKRTKKKSGGKRR--- 2623
            .||...|...|.:              :.::.|.|....|.:..:......:...:|||.::   
  Rat   176 LPLGNGIQTMAAS--------------VQRAVTVSSGDVPGSRGAVEGILIQQVFESGGSKKCIQ 226

  Fly  2624 -------------RSANNTNSSKYSNSL------QNCQFCTSGENEDKLLLCDGCDKGYHTYCFK 2669
                         .|.|..|.::..:||      :..|....|.:|.|:          ...|..
  Rat   227 VGGEFYKPSKFEDPSGNLKNKTRGGSSLKPVIRGKGTQVTIPGRDEQKV----------SQQCGV 281

  Fly  2670 PKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRG 2734
            |.:..:|:      |......||.:|.||     ...|::|.||.||||:|..|..|||.::|.|
  Rat   282 PPLPPLPN------EPQVHQKNEDECAVC-----HDGGELICCDGCPRAFHLACLSPPLQEIPSG 335

  Fly  2735 KWYCHGCI------SRAPPPKKR----SAG-----GTSGSSSKSR-RDRDRESGGSAKRRSDN-- 2781
            .|.|..|:      :.:.|.:.|    ||.     |...:|.|:| ..|:..:|..|.....|  
  Rat   336 LWRCSCCLQGRIQQNLSQPEESRPLEPSAETPILLGLRSASEKTRVLSRELPAGSDAAVTYANLL 400

  Fly  2782 ---SKTPAMEHMQQQQMPLAGGDSHHHHHQQPPSLNSS---HDESMNSLPAAPLSPAHSVVSATN 2840
               |..|.:|......:|.||.:.     |..|:|::.   ..:|.:.|..|             
  Rat   401 APPSTAPVLEPSALCPLPSAGAEG-----QPGPTLSARCGVCGDSTDVLRCA------------- 447

  Fly  2841 YDDQHHANNSVDGSSRFHAHLIPPSNN--------------GTAALLEDVPGGANVMPGVYPV-- 2889
                 |...:......|....:.|..|              |...  |.||......||:..|  
  Rat   448 -----HCAAAFHWRCHFPMAAVRPGTNLRCKSCSAEPTPTPGVPG--EAVPTAVRPTPGLAKVGD 505

  Fly  2890 ----YTPVAAGNFSAGLINQAPVQPAMPFANVVAMS-PRAVTP 2927
                :.||...:....|:|:......:.:| :.:|| |.|.||
  Rat   506 DSASHDPVLHRDDLESLLNEHSFDGILQWA-IQSMSRPLAETP 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
touNP_001097270.1 HAT_MBD 953..1027 CDD:238691
ZapA 1021..1127 CDD:294720
MAP7 1043..1198 CDD:283355
RILP-like 1085..>1179 CDD:304877
DDT 1255..1317 CDD:280886
WHIM1 1406..1455 CDD:292246
WHIM3 2190..2224 CDD:292248
PHD_BAZ2A_like 2640..2685 CDD:277020 7/44 (16%)
RanBP2-type Zn finger 2640..2659 CDD:275375 4/18 (22%)
RanBP2-type Zn finger 2680..2698 CDD:275376 4/17 (24%)
PHD 2695..2744 CDD:279022 21/54 (39%)
Bromo_BAZ2A_B_like 3027..3123 CDD:99935
AireXP_006256309.1 Sp100 17..103 CDD:281203
SAND 198..264 CDD:295351 9/65 (14%)
PHD1_AIRE 300..342 CDD:277014 20/46 (43%)
PHD2_AIRE 433..475 CDD:277015 7/59 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.