| Sequence 1: | NP_001097270.1 | Gene: | tou / 36241 | FlyBaseID: | FBgn0033636 | Length: | 3131 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006538992.1 | Gene: | Chd5 / 269610 | MGIID: | 3036258 | Length: | 1955 | Species: | Mus musculus |
| Alignment Length: | 432 | Identity: | 86/432 - (19%) |
|---|---|---|---|
| Similarity: | 137/432 - (31%) | Gaps: | 200/432 - (46%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2502 KSIMKAYATKNKSSKKKSSAKKQA-----------------TPSKKQQQK-KNKKEQQLTPNGKE 2548
Fly 2549 SKSK-------------SAINKPENQAPLSIK------------------INLKALAQNGQCLLK 2582
Fly 2583 TKTP----------------------------------------------PILTKSPTASPSSHP 2601
Fly 2602 -----------------NTSDSDSD--------------FGKRTKKKSGGK----RRRSANNTNS 2631
Fly 2632 SKYSNSLQN--------------------------------CQFCTSGENEDKLLLCDGCDKGYH 2664
Fly 2665 TYCFKPKMDNIPDGDWYCYECVN-------KATNERK---------------CIVCGGHRPSPVG 2707
Fly 2708 KMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPK 2749 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tou | NP_001097270.1 | HAT_MBD | 953..1027 | CDD:238691 | |
| ZapA | 1021..1127 | CDD:294720 | |||
| MAP7 | 1043..1198 | CDD:283355 | |||
| RILP-like | 1085..>1179 | CDD:304877 | |||
| DDT | 1255..1317 | CDD:280886 | |||
| WHIM1 | 1406..1455 | CDD:292246 | |||
| WHIM3 | 2190..2224 | CDD:292248 | |||
| PHD_BAZ2A_like | 2640..2685 | CDD:277020 | 15/76 (20%) | ||
| RanBP2-type Zn finger | 2640..2659 | CDD:275375 | 6/50 (12%) | ||
| RanBP2-type Zn finger | 2680..2698 | CDD:275376 | 6/39 (15%) | ||
| PHD | 2695..2744 | CDD:279022 | 19/48 (40%) | ||
| Bromo_BAZ2A_B_like | 3027..3123 | CDD:99935 | |||
| Chd5 | XP_006538992.1 | CHDNT | 148..203 | CDD:369683 | 7/54 (13%) |
| PHD1_CHD_II | 347..389 | CDD:277006 | 15/44 (34%) | ||
| PHD2_CHD_II | 420..462 | CDD:277007 | 18/46 (39%) | ||
| CD1_tandem_CHD3-4_like | 467..546 | CDD:349314 | 1/2 (50%) | ||
| CD2_tandem_CHD3-4_like | 591..644 | CDD:349309 | |||
| PLN03142 | 700..>1218 | CDD:215601 | |||
| DUF1087 | 1300..1359 | CDD:368924 | |||
| DUF1086 | 1393..1534 | CDD:368921 | |||
| PRK13108 | <1535..1687 | CDD:237284 | |||
| CHDCT2 | 1733..1904 | CDD:369684 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0383 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||