| Sequence 1: | NP_001097270.1 | Gene: | tou / 36241 | FlyBaseID: | FBgn0033636 | Length: | 3131 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001355360.1 | Gene: | phf-32 / 184600 | WormBaseID: | WBGene00008902 | Length: | 208 | Species: | Caenorhabditis elegans |
| Alignment Length: | 208 | Identity: | 44/208 - (21%) |
|---|---|---|---|
| Similarity: | 72/208 - (34%) | Gaps: | 82/208 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2670 PKMDNIPDGDWYCYECVNKATNE-----------RKCIVCGGHRPSPVGKMIYCDLCPRAYHADC 2723
Fly 2724 YIPPLLKVP---RGKWYCHGCISRAPPPKKRSAGGTSGSSSKSRRDRDRESGGSAKRRSDNSKTP 2785
Fly 2786 AMEHMQQQQMPLAGGDSHHHHHQQPPSLNSSHDESMNS-LPAAPLSPAHSVVSATNYDDQHHA-N 2848
Fly 2849 NSVDGSSRFHAHL 2861 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tou | NP_001097270.1 | HAT_MBD | 953..1027 | CDD:238691 | |
| ZapA | 1021..1127 | CDD:294720 | |||
| MAP7 | 1043..1198 | CDD:283355 | |||
| RILP-like | 1085..>1179 | CDD:304877 | |||
| DDT | 1255..1317 | CDD:280886 | |||
| WHIM1 | 1406..1455 | CDD:292246 | |||
| WHIM3 | 2190..2224 | CDD:292248 | |||
| PHD_BAZ2A_like | 2640..2685 | CDD:277020 | 3/14 (21%) | ||
| RanBP2-type Zn finger | 2640..2659 | CDD:275375 | |||
| RanBP2-type Zn finger | 2680..2698 | CDD:275376 | 7/28 (25%) | ||
| PHD | 2695..2744 | CDD:279022 | 14/51 (27%) | ||
| Bromo_BAZ2A_B_like | 3027..3123 | CDD:99935 | |||
| phf-32 | NP_001355360.1 | PHD_SF | 32..71 | CDD:389947 | 12/45 (27%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0383 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||