DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and YHP1

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:54/219 - (24%)
Similarity:86/219 - (39%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 PPLSSSA-------SSLASP-----PPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSR 369
            |||::||       :...||     |...:...:...|...|:|.:..|.....:|....:|:.|
Yeast    44 PPLAASAHIVRPVVNIYKSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVR 108

  Fly   370 LGASGSGVNASSPQPQPIPPPSAVSRDSGMESSDDTR-----SETGSTTTEGGKNEMWPAWVYCT 429
            :        .|..|    ||.|       |.|.....     |...:..|...:.|...::.:.|
Yeast   109 V--------CSKEQ----PPQS-------MHSYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFIT 154

  Fly   430 RYSDRPSSGPRYRRPKQPK-DKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGL 493
            ...:   :.|:    |:|| |.....:|.|...||.:|..|:..|:|.....:.:|.:||.:..:
Yeast   155 HSQE---TFPK----KEPKIDNARLARRKRRRTSSYELGILQTAFDECPTPNKAKRIELSEQCNM 212

  Fly   494 NEAQIKIWFQNKRAKIKKSTGSKN 517
            :|..::|||||||...||...|.|
Yeast   213 SEKSVQIWFQNKRQAAKKHKNSGN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 18/52 (35%)
Engrail_1_C_sig 512..541 CDD:287495 2/6 (33%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.