DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and RSC58

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_013133.1 Gene:RSC58 / 850720 SGDID:S000004023 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:44/212 - (20%)
Similarity:76/212 - (35%) Gaps:62/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 NSSPSSRLGASGSGVNASSPQPQPIPPPSAVSR--------------------DSGMESSDDTRS 407
            |.:|  |||..|:  |.|:.....:||...::|                    :|...|.::..:
Yeast   239 NEAP--RLGFVGA--NTSNIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYGNYNSWAPSFNENGT 299

  Fly   408 ETGSTTTEGGKNEMWPAWV-YCTRYSDRPSSGPRYRRPKQPKDK----TNDEKRPRTAFSSEQLA 467
            ...|||    :..:|...: |...|.         :..|:.|.:    ||:|...|         
Yeast   300 VVDSTT----RGLIWLERIGYMDLYE---------KNEKKVKQEELLNTNEEGINR--------- 342

  Fly   468 RLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHT 532
               ::.:||....:.:...:..:.|.|:....|...|     .:||.:|....::|  |.|||.|
Yeast   343 ---KQNDENNKNVDGKSNGVQDDGGDNDNDATIASAN-----SESTENKEQFIIKL--QNLYNWT 397

  Fly   533 TVPLTKEEEELEMRMNG 549
            ..... .::|:|...||
Yeast   398 PSNYI-GDDEIENFRNG 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 7/52 (13%)
Engrail_1_C_sig 512..541 CDD:287495 9/28 (32%)
RSC58NP_013133.1 Bromodomain 39..122 CDD:413371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.