powered by:
Protein Alignment en and Cphx1
DIOPT Version :9
Sequence 1: | NP_523700.2 |
Gene: | en / 36240 |
FlyBaseID: | FBgn0000577 |
Length: | 552 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038951152.1 |
Gene: | Cphx1 / 502042 |
RGDID: | 1565219 |
Length: | 234 |
Species: | Rattus norvegicus |
Alignment Length: | 55 |
Identity: | 20/55 - (36%) |
Similarity: | 31/55 - (56%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 454 EKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAK 508
:.:||..|::::|.|||:||....|.....|.:|:.:.......|..|||||||:
Rat 34 KSKPRHKFTNDELKRLKQEFKCTPYPDFTTRDELARQFRCQVDVIDNWFQNKRAR 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24341 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.