DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment en and Cphx1

DIOPT Version :9

Sequence 1:	NP_523700.2	Gene:	en / 36240	FlyBaseID:	FBgn0000577	Length:	552	Species:	Drosophila melanogaster
Sequence 2:	XP_038951152.1	Gene:	Cphx1 / 502042	RGDID:	1565219	Length:	234	Species:	Rattus norvegicus

Alignment Length:	55	Identity:	20/55 - (36%)
Similarity:	31/55 - (56%)	Gaps:	0/55 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   454 EKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAK 508
            :.:||..|::::|.|||:||....|.....|.:|:.:.......|..|||||||:
  Rat    34 KSKPRHKFTNDELKRLKQEFKCTPYPDFTTRDELARQFRCQVDVIDNWFQNKRAR 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
en	NP_523700.2	Homeobox	457..510	CDD:278475	20/52 (38%)
en	NP_523700.2	Engrail_1_C_sig	512..541	CDD:287495
Cphx1	XP_038951152.1	HOX	34..88	CDD:197696	19/53 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24341
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100