DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and En2

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001102684.1 Gene:En2 / 499964 RGDID:1561842 Length:323 Species:Rattus norvegicus


Alignment Length:225 Identity:107/225 - (47%)
Similarity:136/225 - (60%) Gaps:34/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 PAAPTMTQPPLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGAS 373
            ||.......|||.     ||..||::....|.|.|:...:...    .....||:.:..:| |..
  Rat   123 PACAPSAGGPLSG-----ASGDPAADGEGGSKTLSLHGGAKKP----GDPGGSLDGALKAR-GLG 177

  Fly   374 GSGVNASSPQPQPIPPPSAVSRDSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSG 438
            |..::.||                   .||.::    ::.|.|.:..:|||||||||||||||||
  Rat   178 GGDLSVSS-------------------DSDSSQ----ASATLGAQPMLWPAWVYCTRYSDRPSSG 219

  Fly   439 PRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQ 503
            ||.|:||: |:...::|||||||::|||.|||.||..||||||:|||.|:.||.|||:|||||||
  Rat   220 PRSRKPKK-KNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQ 283

  Fly   504 NKRAKIKKSTGSKNPLALQLMAQGLYNHTT 533
            ||||||||:||:||.||:.|||||||||:|
  Rat   284 NKRAKIKKATGNKNTLAVHLMAQGLYNHST 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 40/52 (77%)
Engrail_1_C_sig 512..541 CDD:287495 16/22 (73%)
En2NP_001102684.1 Homeobox 237..290 CDD:278475 40/52 (77%)
Engrail_1_C_sig 292..321 CDD:287495 16/22 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7281
eggNOG 1 0.900 - - E1_KOG0493
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm9047
orthoMCL 1 0.900 - - OOG6_106342
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.