DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and Hoxc5

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 / 315341 RGDID:1307584 Length:222 Species:Rattus norvegicus


Alignment Length:199 Identity:60/199 - (30%)
Similarity:88/199 - (44%) Gaps:24/199 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPIPP 389
            |:..||||.:.|......:....:......||:||     :|...||...:.........|....
  Rat    46 SITFPPPAPSNSLHGVDMAANPRAHPDRPACSAAA-----APGHALGRDEAAPLNPGMYSQKAAR 105

  Fly   390 PSAVSRDSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYR--RPKQPKDKTN 452
            |:...|   .:||.:.:.|...|....|.::              |.:.|:..  ..|.......
  Rat   106 PALEER---AKSSGEIKEEQAQTGQPAGLSQ--------------PPAPPQIYPWMTKLHMSHET 153

  Fly   453 DEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKN 517
            |.||.||:::..|...|::||:.|||||.|||.::::.|.|||.||||||||:|.|.||.:..|:
  Rat   154 DGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKS 218

  Fly   518 PLAL 521
            ..||
  Rat   219 KEAL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 28/52 (54%)
Engrail_1_C_sig 512..541 CDD:287495 3/10 (30%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 17/98 (17%)
Homeobox 158..212 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.