DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and hoxc5a

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_571219.2 Gene:hoxc5a / 30379 ZFINID:ZDB-GENE-980526-533 Length:233 Species:Danio rerio


Alignment Length:182 Identity:58/182 - (31%)
Similarity:90/182 - (49%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 STSSVATSSSSSSSGCSSAASSLNSSPSSR--LGASGSGVNASSPQPQPIPPPSAVSR--DSGME 400
            |:::|..:.|.|:.|..|..|:...:|.|.  |.....|      ..:.:..||..||  |..||
Zfish    71 SSAAVQRTQSCSALGSRSFVSTHGYNPLSHGLLSQKAEG------NMEVMEKPSGKSRTDDIKME 129

  Fly   401 SSDDTRSETGSTTTEG-GKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSE 464
            ::...:.:|.||..:. .:.:::| |:                 .|......:|.||.||:::..
Zfish   130 TTSAIKQQTNSTQRQNQSQPQIYP-WM-----------------TKLHMSHESDGKRSRTSYTRY 176

  Fly   465 QLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSK 516
            |...|::||:.|||||.|||.::::.|.|||.||||||||:|.|.||.:..|
Zfish   177 QTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKLK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 28/52 (54%)
Engrail_1_C_sig 512..541 CDD:287495 1/5 (20%)
hoxc5aNP_571219.2 Homeobox 169..222 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.