DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and en1a

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_571120.2 Gene:en1a / 30244 ZFINID:ZDB-GENE-980526-216 Length:231 Species:Danio rerio


Alignment Length:243 Identity:113/243 - (46%)
Similarity:143/243 - (58%) Gaps:51/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 ASSLASPP--PA-------------------SNASTISSTSSVATSS--SSSSSGCSSAASSLNS 364
            :.||.|||  ||                   .....::..|.|..::  .|.|.|.||:|||..|
Zfish    15 SGSLPSPPLLPAHRNTDFFIDNILRPDFGCKRERERVTRDSGVRPTAVLDSRSDGVSSSASSTVS 79

  Fly   365 SPSSRLGASGSGVNASSPQPQPIPPPSAVSRDSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCT 429
            ||            .||.|...:...|               |::.|.:.:..|..:||||||||
Zfish    80 SP------------VSSSQSNKVEQGS---------------SKSSSPSKDSQKQILWPAWVYCT 117

  Fly   430 RYSDRPSSGPRYRRPKQPKDKT-NDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGL 493
            |||||||||||.|:.|:..:.| :|:|||||||::|||.|||.||..:||:||:|||.|:.||||
Zfish   118 RYSDRPSSGPRTRKLKKKNNNTESDDKRPRTAFTAEQLQRLKAEFQTSRYITEQRRQALARELGL 182

  Fly   494 NEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTTVPLTKEEE 541
            ||:||||||||||||||||:|.||.||:||||||||||:|..:.:||:
Zfish   183 NESQIKIWFQNKRAKIKKSSGFKNALAMQLMAQGLYNHSTTTIQEEED 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 39/52 (75%)
Engrail_1_C_sig 512..541 CDD:287495 18/28 (64%)
en1aNP_571120.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 7/13 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..105 19/88 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..148 15/26 (58%)
Homeobox 146..199 CDD:306543 39/52 (75%)
Engrail_1_C_sig 201..230 CDD:313702 18/28 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577713
Domainoid 1 1.000 97 1.000 Domainoid score I7156
eggNOG 1 0.900 - - E1_KOG0493
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3574
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm6346
orthoMCL 1 0.900 - - OOG6_106342
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2569
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.