DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and en2a

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_571119.2 Gene:en2a / 30243 ZFINID:ZDB-GENE-980526-167 Length:265 Species:Danio rerio


Alignment Length:225 Identity:108/225 - (48%)
Similarity:134/225 - (59%) Gaps:40/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSP 382
            |...|...:.|..||..|||           :.:|||                     |..|...
Zfish    76 PTGPSTGQVGSTVPAEEAST-----------THTSSG---------------------GKEAEIE 108

  Fly   383 QPQPIPPPSA-VSRDSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQ 446
            ..:|:.|... |.:..|.||.....:..|.|    |:..:|||||||||||||||||||.|:||:
Zfish   109 SEEPLKPRGENVDQCLGSESDSSQSNSNGQT----GQGMLWPAWVYCTRYSDRPSSGPRSRKPKK 169

  Fly   447 PKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKK 511
             |..:.::|||||||::|||.|||.||..||||||:|||.|:.||||||:|||||||||||||||
Zfish   170 -KAASKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIWFQNKRAKIKK 233

  Fly   512 STGSKNPLALQLMAQGLYNHTTVPLTKEEE 541
            ::|.||.||:.|||||||||:|.  :||::
Zfish   234 ASGVKNGLAIHLMAQGLYNHSTT--SKEDK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 41/52 (79%)
Engrail_1_C_sig 512..541 CDD:287495 17/28 (61%)
en2aNP_571119.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..142 22/101 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..180 15/25 (60%)
Homeobox 179..232 CDD:278475 41/52 (79%)
Engrail_1_C_sig 234..263 CDD:287495 17/30 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7156
eggNOG 1 0.900 - - E1_KOG0493
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3574
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm6346
orthoMCL 1 0.900 - - OOG6_106342
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.