DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and en2b

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio


Alignment Length:190 Identity:105/190 - (55%)
Similarity:130/190 - (68%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 SSPSSRLGASGSGVNASSPQPQPIPPPSAVSRDSGMESSDDTRSETGS------------TTTEG 416
            |:|.|...|..||...|||:.......:.:|.|..::|    |:|||.            ...:.
Zfish    75 SAPGSGQVAPVSGEGTSSPRAVNASKKTDISTDESLKS----RAETGDQCLSSDSDCSQRCAAQA 135

  Fly   417 GKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTE 481
            .:..:|||||||||||||||||||.|:||: |..|.::|||||||::|||.|||.||..||||||
Zfish   136 KQPMLWPAWVYCTRYSDRPSSGPRSRKPKK-KTPTKEDKRPRTAFTAEQLQRLKNEFQNNRYLTE 199

  Fly   482 RRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTTVPLTKEEE 541
            :|||.|:.||||||:|||||||||||||||:||:||.||:.|||||||||.||  ||:::
Zfish   200 QRRQALAQELGLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHATV--TKDDK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 41/52 (79%)
Engrail_1_C_sig 512..541 CDD:287495 19/28 (68%)
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 15/24 (63%)
Homeobox 175..228 CDD:278475 41/52 (79%)
Engrail_1_C_sig 230..259 CDD:287495 19/30 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7156
eggNOG 1 0.900 - - E1_KOG0493
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3574
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm6346
orthoMCL 1 0.900 - - OOG6_106342
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
1212.320

Return to query results.
Submit another query.