Sequence 1: | NP_523700.2 | Gene: | en / 36240 | FlyBaseID: | FBgn0000577 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001418.2 | Gene: | EN2 / 2020 | HGNCID: | 3343 | Length: | 333 | Species: | Homo sapiens |
Alignment Length: | 238 | Identity: | 106/238 - (44%) |
---|---|---|---|
Similarity: | 129/238 - (54%) | Gaps: | 62/238 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 355 CSSAASSLNSSPSSRLGASGS----GVNAS-------SPQPQPIPP---------PSAVSRDSG- 398
Fly 399 --------------------------------------MESSDDTRSETGSTTTEGGKNEMWPAW 425
Fly 426 VYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSE 490
Fly 491 LGLNEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTT 533 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
en | NP_523700.2 | Homeobox | 457..510 | CDD:278475 | 40/52 (77%) |
Engrail_1_C_sig | 512..541 | CDD:287495 | 16/22 (73%) | ||
EN2 | NP_001418.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..49 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 95..206 | 19/110 (17%) | |||
homeobox domain | 243..302 | 44/58 (76%) | |||
Homeobox | 247..300 | CDD:306543 | 40/52 (77%) | ||
Engrail_1_C_sig | 302..331 | CDD:313702 | 16/22 (73%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 94 | 1.000 | Domainoid score | I7480 |
eggNOG | 1 | 0.900 | - | - | E1_KOG0493 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002003 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8573 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106342 | |
Panther | 1 | 1.100 | - | - | O | PTHR24341 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2569 |
SonicParanoid | 1 | 1.000 | - | - | X1139 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
10 | 9.800 |