DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and EN2

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001418.2 Gene:EN2 / 2020 HGNCID:3343 Length:333 Species:Homo sapiens


Alignment Length:238 Identity:106/238 - (44%)
Similarity:129/238 - (54%) Gaps:62/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 CSSAASSLNSSPSSRLGASGS----GVNAS-------SPQPQPIPP---------PSAVSRDSG- 398
            |:.|............||||:    |...|       |.:|:..||         |:|.|...| 
Human    89 CAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLLGSGSREPRQNPPCAPGAGGPLPAAGSDSPGD 153

  Fly   399 --------------------------------------MESSDDTRSETGSTTTEGGKNEMWPAW 425
                                                  ..|||...|:.|:..  |.:..:||||
Human   154 GEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANL--GAQPMLWPAW 216

  Fly   426 VYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSE 490
            |||||||||||||||.|:||: |:...::|||||||::|||.|||.||..||||||:|||.|:.|
Human   217 VYCTRYSDRPSSGPRSRKPKK-KNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQE 280

  Fly   491 LGLNEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTT 533
            |.|||:|||||||||||||||:||:||.||:.|||||||||:|
Human   281 LSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHST 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 40/52 (77%)
Engrail_1_C_sig 512..541 CDD:287495 16/22 (73%)
EN2NP_001418.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..206 19/110 (17%)
homeobox domain 243..302 44/58 (76%)
Homeobox 247..300 CDD:306543 40/52 (77%)
Engrail_1_C_sig 302..331 CDD:313702 16/22 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7480
eggNOG 1 0.900 - - E1_KOG0493
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm8573
orthoMCL 1 0.900 - - OOG6_106342
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2569
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.