DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and ceh-58

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_496234.3 Gene:ceh-58 / 182371 WormBaseID:WBGene00007417 Length:327 Species:Caenorhabditis elegans


Alignment Length:305 Identity:61/305 - (20%)
Similarity:104/305 - (34%) Gaps:105/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 AAAAAATAA---MMLERANFL-NCFNPAAYPR---IHEEIVQSRLRRSAANAVIPPPMSSKM--- 286
            |.|..||..   ::.:|.:.: |..:|....|   |.|||....:::|  ..|.|..:.::.   
 Worm    82 APAPIATPVLKPLLPQRESIVSNGIHPVVVKRKQSIAEEIDTPEIKKS--RVVEPVKVKTETIIL 144

  Fly   287 --SDANPEKSALGSLCKAVSQIGQPAAPTMTQPPLSSSASSLASPPPASNASTISST--SSVATS 347
              .|.|...:.|.:|     |.|        ...:..:.|..:|...|||:|.|...  ....||
 Worm   145 DDDDGNVLDTVLAAL-----QNG--------NHEMQFTGSGGSSDDGASNSSNIYDVDDEDYGTS 196

  Fly   348 S----------SSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPIPPPSAVSRDSGMESS 402
            .          :|..:..|....::.||||...|.:.:|       .:.:||             
 Worm   197 QWNPDFLTNFITSQPNIFSVTGQNIKSSPSKNAGQTPNG-------KRQVPP------------- 241

  Fly   403 DDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLA 467
                     ..|..||.                                   :|.|..:|:::|.
 Worm   242 ---------MLTVNGKT-----------------------------------RRGRIVYSTQELN 262

  Fly   468 RLKREFNE--NRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIK 510
            .|::.:.|  |.....|:|:.:...|.::..::|:||||:|.|.|
 Worm   263 ILEKYYEEDPNACADPRKRETMCKTLSIDYHRLKVWFQNRRRKDK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 16/54 (30%)
Engrail_1_C_sig 512..541 CDD:287495
ceh-58NP_496234.3 HOX 249..307 CDD:197696 17/92 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.