DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and nob-1

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_001369824.1 Gene:nob-1 / 176641 WormBaseID:WBGene00003779 Length:243 Species:Caenorhabditis elegans


Alignment Length:227 Identity:63/227 - (27%)
Similarity:96/227 - (42%) Gaps:65/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 SNASTISSTSSVATSSSSSSSGCSSAASSLNS----SPSSRLGASGSGVNASSPQPQPIPPPSAV 393
            :|.|...|..|: ||...:.....|||:::.|    |.|.|...:|     ||||..|......:
 Worm    10 NNDSPEDSKESI-TSVQQTPFFWPSAAAAIPSIQGESRSERESETG-----SSPQLAPSSTGMVM 68

  Fly   394 SRDSGMESSDDTRSETGSTTTEGGKNE----MWPAWVYCTRYSDRP--SSG-PRYRRPKQ----- 446
            ...:||.....:|..|.        ||    |.|.:   |.:...|  |:| ..|.:|.|     
 Worm    69 PGTAGMYGFGPSRMPTA--------NEFGMMMNPVY---TDFYQNPLASTGWYSYGQPYQFTANY 122

  Fly   447 --------------------------------PKDKTNDEKRPRTAFSSEQLARLKREFNENRYL 479
                                            |...::|.|:.|..:..:|::||:.|::.|:||
 Worm   123 SIPSLDGNLSDITIPTTAGSSAATTPNAAMHLPWAISHDGKKKRQPYKKDQISRLEYEYSVNQYL 187

  Fly   480 TERRRQQLSSELGLNEAQIKIWFQNKRAKIKK 511
            |.:||.:||::|.|:|.|:|:||||:|.|.||
 Worm   188 TNKRRSELSAQLMLDEKQVKVWFQNRRMKDKK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 24/52 (46%)
Engrail_1_C_sig 512..541 CDD:287495 63/227 (28%)
nob-1NP_001369824.1 Homeobox 165..219 CDD:395001 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.