Sequence 1: | NP_523700.2 | Gene: | en / 36240 | FlyBaseID: | FBgn0000577 | Length: | 552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_783857.1 | Gene: | Hoxc5 / 15424 | MGIID: | 96196 | Length: | 222 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 60/199 - (30%) |
---|---|---|---|
Similarity: | 88/199 - (44%) | Gaps: | 24/199 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 325 SLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGASGSGVNASSPQPQPIPP 389
Fly 390 PSAVSRDSGMESSDDTRSETGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYR--RPKQPKDKTN 452
Fly 453 DEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKN 517
Fly 518 PLAL 521 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
en | NP_523700.2 | Homeobox | 457..510 | CDD:278475 | 28/52 (54%) |
Engrail_1_C_sig | 512..541 | CDD:287495 | 3/10 (30%) | ||
Hoxc5 | NP_783857.1 | COG5373 | 65..>142 | CDD:227665 | 17/98 (17%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..141 | 17/94 (18%) | |||
Antp-type hexapeptide | 140..145 | 0/4 (0%) | |||
Homeobox | 158..212 | CDD:395001 | 28/53 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |