DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and En2

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_034264.1 Gene:En2 / 13799 MGIID:95390 Length:324 Species:Mus musculus


Alignment Length:232 Identity:103/232 - (44%)
Similarity:130/232 - (56%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 SGCSSAASSLNSSPSSRLGASGSG-----VNASSPQPQPIPPPS------------AVSRDSGME 400
            :|...|......:.::..|..|:|     :.|...:|.|...||            ||..:.|.:
Mouse    86 AGAGGARGGEGGAGTTEGGGGGAGGAEQLLGARESRPNPACAPSAGGTLSAAAGDPAVDGEGGSK 150

  Fly   401 ----------------------------------SSDDTRSETGSTTTEGGKNEMWPAWVYCTRY 431
                                              |||...|:..:|.  |.:..:||||||||||
Mouse   151 TLSLHGGAKKPGDPGGSLDGVLKARGLGGGDLSVSSDSDSSQASATL--GAQPMLWPAWVYCTRY 213

  Fly   432 SDRPSSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEA 496
            |||||||||.|:||: |:...::|||||||::|||.|||.||..||||||:|||.|:.||.|||:
Mouse   214 SDRPSSGPRSRKPKK-KNPNKEDKRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNES 277

  Fly   497 QIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTT 533
            |||||||||||||||:||:||.||:.|||||||||:|
Mouse   278 QIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHST 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 40/52 (77%)
Engrail_1_C_sig 512..541 CDD:287495 16/22 (73%)
En2NP_034264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..174 12/84 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..240 15/25 (60%)
Homeobox 238..291 CDD:278475 40/52 (77%)
Engrail_1_C_sig 293..322 CDD:287495 16/22 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7450
eggNOG 1 0.900 - - E1_KOG0493
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm8801
orthoMCL 1 0.900 - - OOG6_106342
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2569
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.