DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and en2

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_002932525.1 Gene:en2 / 100498251 XenbaseID:XB-GENE-853108 Length:266 Species:Xenopus tropicalis


Alignment Length:192 Identity:104/192 - (54%)
Similarity:129/192 - (67%) Gaps:9/192 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 SSSSSGCSSAASSLNSSPSSRLGASGS-GVNASSPQPQPIP-PPSAVSRDSGME---SSDDTRSE 408
            |...||..|.|.|.:...::..||.|| .:..:..:...|. ..|..||....:   |||...|:
 Frog    67 SGRDSGALSGAESAHHRANATEGAGGSKAITLTGDKKSDIAMEESLKSRGHNGDHSLSSDSDSSQ 131

  Fly   409 TGSTTTEGGKNEMWPAWVYCTRYSDRPSSGPRYRRPKQPKDK--TNDEKRPRTAFSSEQLARLKR 471
            ..|.|::  :..:|||||||||||||||||||.|:||:....  |.::|||||||:::||.|||.
 Frog   132 ASSKTSQ--QPMLWPAWVYCTRYSDRPSSGPRSRKPKKKTTTTVTKEDKRPRTAFTADQLQRLKA 194

  Fly   472 EFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTT 533
            ||..||||||:|||.|:.||.|||:|||||||||||||||:||:||.|||.|||||||||:|
 Frog   195 EFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNSLALHLMAQGLYNHST 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 39/52 (75%)
Engrail_1_C_sig 512..541 CDD:287495 17/22 (77%)
en2XP_002932525.1 Homeobox 180..234 CDD:365835 40/53 (75%)
Engrail_1_C_sig 235..264 CDD:371115 17/22 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7421
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm9467
Panther 1 1.100 - - O PTHR24341
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2569
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.