DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment en and en1

DIOPT Version :9

Sequence 1:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster
Sequence 2:XP_031749496.1 Gene:en1 / 100493090 XenbaseID:XB-GENE-5737237 Length:228 Species:Xenopus tropicalis


Alignment Length:236 Identity:113/236 - (47%)
Similarity:138/236 - (58%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 PAAPTMTQPPLSSSASSLASPPPASNASTISSTSSVATSS-SSSSSGCSSAASSLNSSPSSRLGA 372
            |.||...:|.        |||||...|:....|::....: .....||...... ..:||...|.
 Frog     9 PGAPHQPEPG--------ASPPPLHPAAPSHRTTNFFIDNILRPDFGCRKEPPG-RDNPSPLHGH 64

  Fly   373 SGSGVNASSPQPQPIPPPSAVSRDSGMESSDDTRSETGSTTTEGGKNE--MWPAWVYCTRYSDRP 435
            .|        .|.|.|.....|..|....|:......|::.|...||:  :||||||||||||||
 Frog    65 QG--------DPTPSPDSDTPSDSSKGSDSNPALLLVGNSATPARKNDPMVWPAWVYCTRYSDRP 121

  Fly   436 SSGPRYRRPKQPKDKTNDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKI 500
            |||||.|:.|:.|.:..| |||||||::|||.|||.||..|||:||:|||.|:.||.|||:||||
 Frog   122 SSGPRTRKLKKKKSEKED-KRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKI 185

  Fly   501 WFQNKRAKIKKSTGSKNPLALQLMAQGLYNHTTVPLTKEEE 541
            |||||||||||:||.||.|||.|||||||||:|..:.::||
 Frog   186 WFQNKRAKIKKATGMKNGLALHLMAQGLYNHSTTTVQEKEE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
enNP_523700.2 Homeobox 457..510 CDD:278475 39/52 (75%)
Engrail_1_C_sig 512..541 CDD:287495 17/28 (61%)
en1XP_031749496.1 MSCRAMM_ClfB <6..>87 CDD:411414 22/94 (23%)
Homeobox 142..196 CDD:395001 40/53 (75%)
Engrail_1_C_sig 197..227 CDD:402244 19/30 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 93 1.000 Domainoid score I7421
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002003
OrthoInspector 1 1.000 - - mtm9467
Panther 1 1.100 - - LDO PTHR24341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1139
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.100

Return to query results.
Submit another query.