DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and RSC58

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_013133.1 Gene:RSC58 / 850720 SGDID:S000004023 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:27/184 - (14%)
Similarity:73/184 - (39%) Gaps:53/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MHPDCLPLPL---VQPGN----SPQVRE------------------------EEEDEQTECEEQL 74
            :||:...||.   ::.||    :|...|                        |:.:::.:.||.|
Yeast   269 LHPNWYALPTTVWLKYGNYNSWAPSFNENGTVVDSTTRGLIWLERIGYMDLYEKNEKKVKQEELL 333

  Fly    75 NIEDEEV----EEEHDLDLEDPASCCSENSVLSVGQEQSEAAQAALSAQAQARQRLLISQIYRPS 135
            |..:|.:    .:|::.:::..::...::.    |...::|..|:.::::...:...|.::  .:
Yeast   334 NTNEEGINRKQNDENNKNVDGKSNGVQDDG----GDNDNDATIASANSESTENKEQFIIKL--QN 392

  Fly   136 AFSSTATTVLPPSEGPPF---SPEDLLQLPPSTGTFQEEFLRKSQLYAEELMKQ 186
            .::.|.:..:...|...|   :|:.|:         .:..|:..:|..|.::.:
Yeast   393 LYNWTPSNYIGDDEIENFRNGTPDKLV---------SDSLLKLKRLRKERILNK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475
Engrail_1_C_sig 529..554 CDD:287495
RSC58NP_013133.1 Bromodomain 39..122 CDD:413371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.