DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Duxf3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_030101272.1 Gene:Duxf3 / 74399 MGIID:1921649 Length:674 Species:Mus musculus


Alignment Length:221 Identity:59/221 - (26%)
Similarity:80/221 - (36%) Gaps:46/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 LVKSPPPAAGAGATGASGKSGEDSGTPIVWPAW----VYCT----RY---------------SD- 427
            :.::..|..|:|....|.:..:     :||.||    :..|    ||               || 
Mouse     1 MAEAGSPVGGSGVARESRRRRK-----MVWQAWQEQALLSTFKEKRYLSFKERKELAKRMGVSDC 60

  Fly   428 ---------RPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGGGV-PEDKRPRTAFSGTQ 482
                     |..||....|  .|:....|..........|.|....|.|: ...:||||..:..|
Mouse    61 RIRVWFQNRRNRSGEEGHA--SKRSIRGSRRLASPQLQEELGSRPQGRGLRSSGRRPRTRLTSLQ 123

  Fly   483 LARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMA-QGLY 546
            ...|...|..|.......|::|:.:.||.|..|.|||||:||:.:...|........|:| ||..
Mouse   124 RRILGQAFERNPRPGFATREELARDTGLPEDTIHIWFQNRRARRRHRRGRPTAQDQDLLASQGSD 188

  Fly   547 NHSTIPLTREEEELQE----LQEAAS 568
            ...|.|..||.|..||    .:||.|
Mouse   189 GAPTGPEGREREGAQESLLPQEEAGS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 20/52 (38%)
Engrail_1_C_sig 529..554 CDD:287495 7/25 (28%)
Duxf3XP_030101272.1 homeodomain 19..73 CDD:238039 10/58 (17%)
HOX 112..162 CDD:197696 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24341
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.