DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Mnx1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001258203.1 Gene:Mnx1 / 682076 RGDID:1588091 Length:403 Species:Rattus norvegicus


Alignment Length:391 Identity:88/391 - (22%)
Similarity:121/391 - (30%) Gaps:167/391 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 ERALKFSIDNILKADFGSRLPKIGALSGNIGGGSVSGSSTGSSKNSGNTNGNRSPLKAPKKSGKP 338
            |::..|.||.:|..|                                       |.:|......|
  Rat     2 EKSKNFRIDALLAVD---------------------------------------PPRAASTQSAP 27

  Fly   339 LNLAQSNAAANSSLS-FSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVK----SPP------ 392
            |.|..|.||..|... ..|......|.::.|.|.|:|.:|    .||.|.::    |||      
  Rat    28 LALVTSLAATPSGPGRGGSGGGGTSSGASRSCSPASSEAT----AAPGDRLRAESPSPPRLLTAH 88

  Fly   393 ----PAAG-AGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGG 452
                |..| .||.|..|.:| ..|||          .:...|.:..:..|      |.:::||||
  Rat    89 CALLPKPGFLGAGGGGGAAG-GPGTP----------HHHAHPGAAAAAAA------AAAAAAAGG 136

  Fly   453 GGGGVEKGEAADGGGVPED---------------------------------------------- 471
            ...|:..|.|..|.|:|..                                              
  Rat   137 LALGLHPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPI 201

  Fly   472 ----------------------------------------KRPRTAFSGTQLARLKHEFNENRYL 496
                                                    :||||||:..||..|:|:|..|:||
  Rat   202 KLGAGTFQLDQWLRASTAGMILPKMPDFSSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYL 266

  Fly   497 TEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQ-----GLYNHSTIPLTRE 556
            :..:|.:::..|.|.|.|:||||||:|.|.|:|...|...|.:...|     |.....|...|.|
  Rat   267 SRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGSGGGAGKGGTEEKTEE 331

  Fly   557 E 557
            |
  Rat   332 E 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 6/29 (21%)
Mnx1NP_001258203.1 Homeobox 244..297 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.