DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb6b

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_571613.1 Gene:hoxb6b / 58053 ZFINID:ZDB-GENE-000823-7 Length:224 Species:Danio rerio


Alignment Length:194 Identity:52/194 - (26%)
Similarity:68/194 - (35%) Gaps:75/194 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 PAAGAGAT----------------GASGKSGE----DSGTPIVWPAWVYCTRYSDR--------- 428
            |:|..|||                |..|:||.    |..||.::       |.:||         
Zfish    40 PSATFGATNVQDKVYTSSYYQQAGGVFGRSGSTSACDYSTPNIY-------RSADRSCAIGSLED 97

  Fly   429 -------------PSSGRSPRARKPKKPAT----------SSSAAGGGGGGVEKGEAADGGGVPE 470
                         ...|.........||.|          |.:...|..|               
Zfish    98 SLVLTQDQCKTDCTEQGTERYFSTEDKPCTPVYPWMQRMNSCNGMPGSTG--------------- 147

  Fly   471 DKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKN 534
             :|.|..::..|...|:.||:.|||||.:||.::|..|.|.|.||||||||:|.|.||.:...|
Zfish   148 -RRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKAVN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 1/6 (17%)
hoxb6bNP_571613.1 Antp-type hexapeptide 129..134 0/4 (0%)
Homeobox 151..203 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.