DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxb3

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:246 Identity:74/246 - (30%)
Similarity:105/246 - (42%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 GNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANI------CSNSNDSNS-------TATSS 375
            |...|.::...|....|..|.::.:..||..|..|...      |...|.|:.       ||..|
 Frog    24 GYEGPQQSFPTSSHMDNEFQRSSCSLQSLGHSGPLVKAKNLNGSCMRPNLSSEQSQPLSPTANPS 88

  Fly   376 STTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKP 440
            |.||:|.:...|.|..|..:.|..:.||.:         ::| |:..:|.:.:..|       .|
 Frog    89 SNTNSSSSQASLSKPSPAKSQASGSPASKQ---------IFP-WMKESRQNSKQKS-------SP 136

  Fly   441 KKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLS 505
            ..||..|.    ||.....|.:|       .||.|||::..||..|:.||:.||||...||.:::
 Frog   137 PAPAAESC----GGDRSPPGSSA-------SKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMA 190

  Fly   506 GELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTRE 556
            ..|.|:|.||||||||:|.|.||....|   .:...:.|....||.||:.:
 Frog   191 NLLNLSERQIKIWFQNRRMKYKKDQKVK---GMSSSSGGASPTSTPPLSMQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 5/24 (21%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 27/51 (53%)
DUF4074 325..384 CDD:315871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.