DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Hoxa7

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001102703.2 Gene:Hoxa7 / 500126 RGDID:1587253 Length:229 Species:Rattus norvegicus


Alignment Length:224 Identity:65/224 - (29%)
Similarity:96/224 - (42%) Gaps:30/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 NSNDSNSTATSS-----STTNTSGAPVDLVKSPPPAAGAGATGASGKSGEDSGTPIVWPAW--VY 421
            |:..|..||.:|     ..|:.|.||........|.|||.|:...|....:|      |.:  .:
  Rat     8 NALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASNVPGLYNVNS------PLYQNPF 66

  Fly   422 CTRYSDRPSSGRSPRARKPKK-PATSSSAAGGGGGGVEKG------EAA--------DGGGVPED 471
            .:.|.....:...|.|...:. |...|..|.|.....::|      ||:        ..|  |:.
  Rat    67 ASSYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYPWMRSSG--PDR 129

  Fly   472 KRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPL 536
            ||.|..::..|...|:.||:.|||||.:||.:::..|.|.|.||||||||:|.|.||....::..
  Rat   130 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDESQA 194

  Fly   537 ALQLMAQGLYNHSTIPLTREEEELQELQE 565
            ...:....:.:.||.....:|||.:|.:|
  Rat   195 PTAVPEDAVPSVSTAADKADEEEEEEEEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
Hoxa7NP_001102703.2 Homeobox 133..185 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.