DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and hoxa1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001008017.1 Gene:hoxa1 / 493379 XenbaseID:XB-GENE-480737 Length:323 Species:Xenopus tropicalis


Alignment Length:355 Identity:82/355 - (23%)
Similarity:127/355 - (35%) Gaps:115/355 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LGLGPGGAVHPHQQLLLQRDQVHHHHHMQNHLNNNENLHERALKFSIDNILKADFGSRLPKIGAL 299
            :|.|...:.||           |||||......::.||                           
 Frog    55 VGRGVQISSHP-----------HHHHHQAGAFQHHNNL--------------------------- 81

  Fly   300 SGNIGGGSVSGSSTGSSKNSGNTNGNRS--PL--KAPKKSGKPL-----NLAQSNAAANSSLSFS 355
                 |.|.:.:|.||:....|.:...|  |:  :|...:|.|.     |:|.|....:...|:.
 Frog    82 -----GMSYTHTSCGSNYGMQNFSPGYSHFPINQEADVSAGFPQSVYSGNIASSVVQHHQHQSYI 141

  Fly   356 SSLANICSNS-NDSNSTATSSSTTNTSGAPV---DLVKSPPPAAGAGATGASGKSGEDSGTPIVW 416
            ...|:...:| ....:.:.::...|.|...:   ::.:||              |.|.|..|...
 Frog   142 EGSAHYIHHSYGPDQNISVANYNNNVSSLHISQREVCRSP--------------SSETSPGPAQT 192

  Fly   417 PAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGT 481
            ..|:..              .|.|.|                .|:|.:.|...:....||.|:..
 Frog   193 FDWMKV--------------KRNPPK----------------TGKAGEYGFAGQPNTARTNFTTK 227

  Fly   482 QLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLY 546
            ||..|:.||:.|:|||..||.:::..|.|||.|:||||||:|.|.||..           .:||.
 Frog   228 QLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKRE-----------KEGLL 281

  Fly   547 NHSTIPLTREEEELQELQEAASAAAAKEPC 576
            ..|....|..:|:.:||.|.::::    ||
 Frog   282 PISPSASTGSDEKSEELSEKSNSS----PC 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 3/24 (13%)
hoxa1NP_001008017.1 Homeobox 221..274 CDD:365835 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.