DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and E5

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:380 Identity:76/380 - (20%)
Similarity:113/380 - (29%) Gaps:176/380 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 TNGNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANICSNSND----SNSTATSSSTTNTSG 382
            |.|.::....|.....|...:.|:.||:|:...:||..:..::|..    |..:....|:|.::.
  Fly     3 TCGRQTFNMLPMAPTSPFVSSSSSVAASSTSVSASSTVSASASSKPKLAFSIDSIVGESSTRSAP 67

  Fly   383 APVDLVKSPPPAAGAGA----TGASGKSGEDSGTPIVWPAWVYCTRYS--DRP-SSGRSPRARKP 440
            ..|.::.||||.:.:.|    |..||:.     ||   ..::||.|..  ||. |..|||.:|.|
  Fly    68 LRVSVISSPPPRSESPASPTNTNNSGRR-----TP---RGYIYCRRRDSLDRSRSPQRSPVSRSP 124

  Fly   441 KKPATSSSAAGGGGGGVEKGEAADGGGVP------------------------------------ 469
            ..|....:.| ..|...:.|:.:.|.|.|                                    
  Fly   125 SPPNAGGNPA-AAGNTAKSGDPSSGTGNPPTLIRPLPLPAPNLALIGNRTSPNAMAVRMAGPPHP 188

  Fly   470 ----------------------------------------------------------------- 469
                                                                             
  Fly   189 PSQPPPFLAAQFQMAAALAHHHQQQQQQQQQQLPPVPTGPPHGPHPHLPPGQIPLGIFPGGPHPG 253

  Fly   470 ------------------------------------------------EDKRPRTAFSGTQLARL 486
                                                            :.||.|||||.|||.:|
  Fly   254 HPPPHGHHPFGSAPHLIRDSYPLYPWLLSRHGRIFPRFPGNFLFQPFRKPKRVRTAFSPTQLLKL 318

  Fly   487 KHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKK-------SSGTKN 534
            :|.|..|.|:....|:||:..|.|.|.|:|:||||:|.|.|:       .|.||:
  Fly   319 EHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKHKRMQQEGGDGSDTKS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 3/6 (50%)
E5NP_524825.1 Homeobox 307..359 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.