DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and pb

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster


Alignment Length:298 Identity:69/298 - (23%)
Similarity:109/298 - (36%) Gaps:70/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 GNIGGGSVSGSSTGSSKNSGNTNGNRSPLKAPKKSGKPLNLAQSNAAANSSLSFSSSLANICSNS 365
            |..||..|.|...|...:.|..                 .:.|.......|:...:.:...|   
  Fly    38 GGCGGAGVVGGVGGVGVSVGQP-----------------GIGQQGVPPVPSVLMVNKMTPNC--- 82

  Fly   366 NDSNSTATSSSTTNTSGAPVDLVKSPPPAA-----------------GAGATGASGKS-GEDSGT 412
             |..|..|:...|.:.|.   .:.|.|..|                 |:||.|..|.: ..:.|.
  Fly    83 -DKRSADTAYWMTASEGG---FINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGV 143

  Fly   413 PIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGGGGGGVEKGEAADGGGVPEDKRPRTA 477
            .:.:|..|.........|....|..::.|....||:....|...:.  |.....|:|  :|.|||
  Fly   144 GVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSIT--EFVPENGLP--RRLRTA 204

  Fly   478 FSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMA 542
            ::.|||..|:.||:.|:||...||.:::..|.|.|.|:|:||||:|.|.|:              
  Fly   205 YTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKR-------------- 255

  Fly   543 QGLYNHSTIPLTREEEELQELQ----EAASAAAAKEPC 576
                  .|:..|.:|:....|:    ::.|.:.:|:.|
  Fly   256 ------QTLSKTDDEDNKDSLKGDDDQSDSNSNSKKSC 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 1/24 (4%)
pbNP_476669.3 COG5576 168..274 CDD:227863 38/129 (29%)
Homeobox 202..254 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.