DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and mnx1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001009885.1 Gene:mnx1 / 405399 ZFINID:ZDB-GENE-040409-1 Length:311 Species:Danio rerio


Alignment Length:283 Identity:73/283 - (25%)
Similarity:106/283 - (37%) Gaps:73/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 PKKSGKPLNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSSTTNTSGAPVDLVKSPPPAAG 396
            ||....||.|..|  ...||:|.||........:.:|::..|.|             .|||..:.
Zfish    18 PKVQTSPLALVTS--LPTSSISSSSDSVQAVELTTNSDALQTES-------------PSPPRISS 67

  Fly   397 AGATGASG-KSGEDSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAAGG-------- 452
            .|.....| .:...||...:.|          :.|:|..|:|.......|.|:||.|        
Zfish    68 CGLIPKPGFLNSPHSGMVGLHP----------QSSTGIPPQALYGHPMYTYSAAALGQHPALSYS 122

  Fly   453 ------------------------------GGGGVEKGEAADGGGVPED------KRPRTAFSGT 481
                                          ...|:...:.||..|..:.      :||||||:..
Zfish   123 YPHGSHHHHHPSDPLKLTASSFQLDHWLRVSTAGMMLPKMADFNGQAQSNLLGKCRRPRTAFTSQ 187

  Fly   482 QLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQ-GL 545
            ||..|:|:|..|:||:..:|.:::..|.|.|.|:||||||:|.|.|:|...|...|.....| |.
Zfish   188 QLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQDAEKQKGK 252

  Fly   546 YNHSTIPLTREEEELQELQEAAS 568
            .||.  .:...|::.|::....|
Zfish   253 GNHD--KMDGLEKDYQKVDSGKS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 7/25 (28%)
mnx1NP_001009885.1 Homeobox 180..233 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.