Sequence 1: | NP_523699.3 | Gene: | inv / 36239 | FlyBaseID: | FBgn0001269 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102307.1 | Gene: | Meox1 / 363684 | RGDID: | 1308911 | Length: | 253 | Species: | Rattus norvegicus |
Alignment Length: | 262 | Identity: | 64/262 - (24%) |
---|---|---|---|
Similarity: | 97/262 - (37%) | Gaps: | 96/262 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 VKSP-PPAAGAGATGASGKSGED-SGTPIVWPAWVYCTRYSDRPSSG---------------RSP 435
Fly 436 RARK---------PKK-----------------PATSSSAAGGGGGGV----------------- 457
Fly 458 ----------EKGEAAD----GGGVPED----KRPRTAFSGTQLARLKHEFNENRYLTEKRRQQL 504
Fly 505 SGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEEELQELQEAASA 569
Fly 570 AA 571 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
inv | NP_523699.3 | Homeobox | 474..527 | CDD:278475 | 25/52 (48%) |
Engrail_1_C_sig | 529..554 | CDD:287495 | 2/24 (8%) | ||
Meox1 | NP_001102307.1 | COG5576 | 139..251 | CDD:227863 | 40/129 (31%) |
Homeobox | 174..227 | CDD:395001 | 25/52 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |