DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and Meox1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:262 Identity:64/262 - (24%)
Similarity:97/262 - (37%) Gaps:96/262 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VKSP-PPAAGAGATGASGKSGED-SGTPIVWPAWVYCTRYSDRPSSG---------------RSP 435
            |::| |||...|........|.. ||.|...|......:.||.|::.               ..|
  Rat     9 VRNPQPPAPVWGCLRNPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLP 73

  Fly   436 RARK---------PKK-----------------PATSSSAAGGGGGGV----------------- 457
            ||.:         |:.                 ||.|:...|.|..|:                 
  Rat    74 RAERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGGLGEDCMVLGTI 138

  Fly   458 ----------EKGEAAD----GGGVPED----KRPRTAFSGTQLARLKHEFNENRYLTEKRRQQL 504
                      .|.|.:|    |||.||.    ::.||||:..||..|:.||..:.|||..||.::
  Rat   139 AHETEKKLSRRKKERSDNPENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEI 203

  Fly   505 SGELGLNEAQIKIWFQNKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEEELQELQEAASA 569
            :..|.|:|.|:|:||||:|.|.|:..|.:                  |::.:|::.::...|||.
  Rat   204 AVNLDLSERQVKVWFQNRRMKWKRVKGGQ------------------PVSPQEQDPEDGDSAASP 250

  Fly   570 AA 571
            ::
  Rat   251 SS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 25/52 (48%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 40/129 (31%)
Homeobox 174..227 CDD:395001 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.