DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXD8

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_062458.1 Gene:HOXD8 / 3234 HGNCID:5139 Length:290 Species:Homo sapiens


Alignment Length:242 Identity:62/242 - (25%)
Similarity:79/242 - (32%) Gaps:100/242 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 SPPPAAGAGATGASGKSGE----DSGTPIVWPAWVYCTRYSDRPSSGRSPRARKPKKPATSSSAA 450
            |||| :|.|..|..|:..|    ..|:|        ...|...|.....|....|..|.      
Human    75 SPPP-SGTGCGGREGRGQEYFHPGGGSP--------AAAYQAAPPPPPHPPPPPPPPPC------ 124

  Fly   451 GGGGGGVEKGEAA------------------------------DGGGVPED-------------- 471
               ||....||.|                              ..|.:.||              
Human   125 ---GGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMF 186

  Fly   472 -----------KRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQNKRAK 525
                       :|.|..:|..|...|:.||..|.|||.|||.::|..|.|.|.|:||||||:|.|
Human   187 PWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMK 251

  Fly   526 LKKSSGTKNPLALQLMAQGLYNHSTIPLTREE-------EELQELQE 565
            .||.:                |....|::|:|       :|.|||:|
Human   252 WKKEN----------------NKDKFPVSRQEVKDGETKKEAQELEE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 2/24 (8%)
HOXD8NP_062458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..127 17/69 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 3/38 (8%)
Homeobox 201..253 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..290 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.