DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXD1

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:342 Identity:86/342 - (25%)
Similarity:128/342 - (37%) Gaps:104/342 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 SSKNSGNTNGNRSPLKAPK---KSGKPLNLAQSNAAANSSLSFSSSLANICSNSNDSNSTATSSS 376
            |..:||...|:...| |||   ...:|:.|..:....|...:|.|.|....:..:.|...|.:..
Human     9 SCSSSGGVGGDVLSL-APKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPARP 72

  Fly   377 TTNTSGAP------VDLVKSP--PPAAGAGAT--------------GASGKSGEDSGT------- 412
            :.....||      ::....|  .|||.||..              |..|::.:|.|:       
Human    73 SVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATS 137

  Fly   413 ----------------------PIVWPAWVYCTRYS----------DRPSSGRSPRARKPKK--P 443
                                  |..:||   |.:.|          ..|:.|..|::..|..  |
Human   138 AVFSGGGSFLLSGQVDYAAFGEPGPFPA---CLKASADGHPGAFQTASPAPGTYPKSVSPASGLP 199

  Fly   444 ATSS---------SAAGGGGGGVEKGEAADGGGVPEDKRPRTAFSGTQLARLKHEFNENRYLTEK 499
            |..|         :|:       :||:.|:.|........||.||..||..|:.||:.|:|||..
Human   200 AAFSTFEWMKVKRNAS-------KKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRA 257

  Fly   500 RRQQLSGELGLNEAQIKIWFQNKRAKLKKSS-----GTKNPLA-LQLMAQGLYNHSTIPLTREEE 558
            ||.:::..|.||:.|:||||||:|.|.||..     .|..|:| |||...|     |.|      
Human   258 RRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQLPLSG-----TTP------ 311

  Fly   559 ELQELQEAASAAAAKEP 575
             .:.::...|.:.::||
Human   312 -TKFIKNPGSPSQSQEP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 27/52 (52%)
Engrail_1_C_sig 529..554 CDD:287495 9/30 (30%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..285 CDD:278475 27/51 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 6/35 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.