DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inv and HOXC6

DIOPT Version :9

Sequence 1:NP_523699.3 Gene:inv / 36239 FlyBaseID:FBgn0001269 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens


Alignment Length:110 Identity:40/110 - (36%)
Similarity:60/110 - (54%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 VEKGEAADGGGVPED-KRPRTAFSGTQLARLKHEFNENRYLTEKRRQQLSGELGLNEAQIKIWFQ 520
            :::..:..|.|...| :|.|..:|..|...|:.||:.|||||.:||.:::..|.|.|.|||||||
Human   126 MQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQ 190

  Fly   521 NKRAKLKKSSGTKNPLALQLMAQGLYNHSTIPLTREEEELQELQE 565
            |:|.|.||.|...:.|     :.|....:...|..:||:.:|.:|
Human   191 NRRMKWKKESNLTSTL-----SGGGGGATADSLGGKEEKREETEE 230

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
invNP_523699.3 Homeobox 474..527 CDD:278475 26/52 (50%)
Engrail_1_C_sig 529..554 CDD:287495 3/24 (13%)